GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:56:35

Sequence DEFA1_1 : 4824 bp : 45.98% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   2074   2157   84  0  0   69  115    22 0.414   3.02
gatgtttctacatggtgtgagataaagatttaaatacatacatatataaaatcatgaggt
agtgtacactataaatatacaattgttaattgttactcaagtctaagtagaggtggaaat
aataaactttcttttttttacttaaaccactctgtgtcactgagctgatttcacctttag
CCTGATAAAATCATTGTCCTCTCCACCCTGATTCCTACAGGAGACTACTCACCCCATAAC
CTCAAAAACCTCTTCATGAGGATG
gtaagtcacctgaatcctgaagtgaattactcgctattccattggaactcatataggaca
ccagaatctagacctccagagaacagcaggacccatcttcagaaaataagaagcatttgt
tccctgagcctgttgaatcaaagtgcaatttctattctttttggaatgttaaaaagtgaa

 1.02 Intr +   2628   2814  187  2  1  135   94   121 0.579  16.66
actgggagaacaggagcattcgagcaaccttgagaccaatgggcctctcttataaaatgc
acacctcctctcactgagattgaggaaggtttcttgtctccgagccttctcccagtagag
ctataaatccaggctggctcctccctccccacacagctgctcctgctctccctcctccag
GTGACCCCAGCCATGAGGACCCTCGCCATCCTTGCTGCCATTCTCCTGGTGGCCCTGCAG
GCCCAGGCTGAGCCACTCCAGGCAAGAGCTGATGAGGTTGCTGCAGCCCCGGAGCAGATT
GCAGCGGACATCCCAGAAGTGGTTGTTTCCCTTGCATGGGACGAAAGCTTGGCTCCAAAG
CATCCAG
gtgagagaggcaggcatgcagagctgctaagtctagagggaaggacgggagagaggttcc
agagttgggtctcagcagtctatgtcactgaggtggcttcacttagaatctctgggcatt
gattttctcatctagaaattgaacagagagccaaataaacatgagaaactttatttctcc

 1.03 Term +   3395   3504  110  0  2  106   49    59 0.964   2.47
tctcaaattctgagtgacaagcactgctctgcgtgtttattcctatcgactgaggttgtt
cgtgctaacggctgcaatgcagccagcatcacctgtcagctagcatgtgacttccccgag
attctttttcttacccactgctaactccatactcaatttctcatgctctccctgtcccag
GCTCAAGGAAAAACATGGCCTGCTATTGCAGAATACCAGCGTGCATTGCAGGAGAACGTC
GCTATGGAACCTGCATCTACCAGGGAAGACTCTGGGCATTCTGCTGCTGA
gcttgcagaaaaagaaaaatgagctcaaaatttgctttgagagctacagggaattgctat
tactcctgtaccttctgctcaatttcctttcctcatcccaaataaatgccttgttacaag
atttctgtgtttccacctctttaatgtgtgatatgtgtctgtgtcaagacacttgggata

Predicted peptide sequence(s):


>DEFA1_1|GENSCAN_predicted_peptide_1|126_aa
PDKIIVLSTLIPTGDYSPHNLKNLFMRMVTPAMRTLAILAAILLVALQAQAEPLQARADE
VAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGR
LWAFCC