GENSCAN 1.0	Date run: 16-Jan-104	Time: 23:56:48

Sequence CYP11B2_1 : 9684 bp : 56.34% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1204   1442  239  0  2   39  103   221 0.839  14.18
gaattaggcacctgacttctccttcatctacctttggctgggggcctccagccttgacct
tcgctctgagagtctcaggcaggtccagagccagttctcccatgacgtgatatgtttcca
gagcaggttcctgggtgagataaaaggatttgggctgaacagggtggagggagcattgga
ATGGCACTCAGGGCAAAGGCAGAGGTGTGCGTGGCAGCGCCCTGGCTGTCCCTGCAAAGG
GCACGGGCACTGGGCACTAGAGCCGCTCGGGCCCCTAGGACGGTGCTGCCGTTTGAAGCC
ATGCCCCAGCATCCAGGCAACAGGTGGCTGAGGCTGCTGCAGATCTGGAGGGAGCAGGGT
TATGAGCACCTGCACCTGGAGATGCACCAGACCTTCCAGGAGCTGGGGCCCATTTTCAG
gtaaagccctccctggccctcgctgggaacacccagatccctgcccctgctgcccaggac
cctgccaggcactcagcactgccattcccagcaggtcccggcactctgcatcctttggag
gatggggaaggagtgcagcacatgctggtctgtggtgctgccagggcaggggatagtgca

 1.02 Intr +   1830   1985  156  0  0   91   55   121 0.995   8.74
ggcaggactcagaagcactaaagttgaaaggttccagggagccagcaggagggctttagc
tgtgaagccgctaatccaggagcagggagggtggacaggagacactttggattgggactg
cagggtggggccacgagggacatgaccccgtccagcagggcctcctgcttggccccacag
GTACAACTTGGGAGGACCACGCATGGTGTGTGTGATGCTGCCGGAGGATGTGGAGAAGCT
GCAACAGGTGGACAGCCTGCATCCCTGCAGGATGATCCTGGAGCCCTGGGTGGCCTACAG
ACAACATCGTGGGCACAAATGTGGCGTGTTCTTGTT
gtaagcggcgagttgggagctgagagctgggagcagggtgggcagcctgggtgtaggggg
gaggcgagagaggtaggacccaaaagcacatctgccctgggcccctgtggtgggcagtga
gggtgagcacccggcccagaggacggccatcctgtggggtcgcgtctgcactgtgggttg

 1.03 Intr +   3799   3998  200  1  2   93   70   309 0.999  29.12
cagcacctggaggccgctctgagaaaaggctgcagctcgaacacaaacaggcagcttcta
ccagggcccccagtcagctccctgcaggccgattccccttggggacaaggaggatgggat
acgggtcagggcctgtgtcttgctggggcggcctcacaagctctgccctggcctctgtag
GAATGGGCCTGAATGGCGCTTCAACCGATTGCGGCTGAACCCAGATGTGCTGTCGCCCAA
GGCCGTGCAGAGGTTCCTCCCGATGGTGGATGCAGTGGCCAGGGACTTCTCCCAGGCCCT
GAAGAAGAAGGTGCTGCAGAACGCCCGGGGGAGCCTGACCCTGGACGTCCAGCCCAGCAT
CTTCCACTACACCATAGAAG
gtgtgggccatgcgggaaggtccagccccagagaccctggagtggccagggatggggatg
gaggactgaagggagtgtggggaggcagccaggaggcctggggctgccttgtgctcagca
gtgcatcctccccgcagccagcaacttagctctttttggagagcggctgggcctggttgg

 1.04 Intr +   4136   4339  204  0  0   76   89   122 0.998  10.80
accctggacgtccagcccagcatcttccactacaccatagaaggtgtgggccatgcggga
aggtccagccccagagaccctggagtggccagggatggggatggaggactgaagggagtg
tggggaggcagccaggaggcctggggctgccttgtgctcagcagtgcatcctccccgcag
CCAGCAACTTAGCTCTTTTTGGAGAGCGGCTGGGCCTGGTTGGCCACAGCCCCAGTTCTG
CCAGCCTGAACTTCCTCCATGCCCTGGAGGTCATGTTCAAATCCACCGTCCAGCTCATGT
TCATGCCCAGGAGCCTGTCTCGCTGGATCAGCCCCAAGGTGTGGAAGGAGCACTTTGAGG
CCTGGGACTGCATCTTCCAGTACG
gtgaggccagggacccgggcagtgctatggggaagggacaccatgggggcccaatttctc
cttctccaccacccagtggggaatggaggccacagggaggggtcggggattcctcacctt
cctgccggggagattggtgcgaggctggggctgggctgggctgatccggagaatttggga

 1.05 Intr +   4626   4780  155  1  2   84   49   243 0.999  20.30
ggattcctcaccttcctgccggggagattggtgcgaggctggggctgggctgggctgatc
cggagaatttgggatgagagcagggagatttgggtgtcggggcagtctgggcaggaggag
gacactgaaggatgcttcccagcaccaagatctgagggctgtcccctgctccctggacag
GTGACAACTGTATCCAGAAAATCTACCAGGAACTGGCCTTCAACCGCCCTCAACACTACA
CAGGCATCGTGGCGGAGCTCCTGTTGAAGGCGGAACTGTCACTAGAAGCCATCAAGGCCA
ACTCTATGGAACTCACTGCAGGGAGCGTGGACACG
gtcaggccagcaaccagccccacccagagagggtgatgccaagcctgcctcccaggcact
gcctgccaatgccacacggcacccacgttccccatccccaggctacaggccccacatttc
tgttgccctcagccttccccctcctttgttaagggatgagatttgcaggggaggggaaat

 1.06 Intr +   5593   5759  167  0  2   35   64   317 0.946  23.27
aagaagtcagggaatctggcccaagtggtcatcaaggtttcagatccggggtcccagggc
tctgtttttgctcagggcatggatgtctccacccctcagagggaggttgtcctgggaggg
gtgtcccgggggctgagtcctcctgtgcaaggtctgaccctgcagacatggcttctgtag
ACAGCGTTTCCCTTGCTGATGACGCTCTTTGAGCTGGCTCGGAACCCCGACGTGCAGCAG
ATCCTGCGCCAGGAGAGCCTGGCCGCCGCAGCCAGCATCAGTGAACATCCCCAGAAGGCA
ACCACCGAGCTGCCCTTGCTGCGGGCGGCCCTCAAGGAGACCTTGCG
gtgggtgctggctgaggcctccctgtggccctggccccctgctggagagcagcccccact
gggtggtggcagacagaatctggggctgataaacagcgtcacccagcagcccattcccct
gcacctgctcttcctccccctcaaggacagggagctcttcttcctctggaatccctcttc

 1.07 Intr +   6159   6237   79  0  1   80   84    52 0.482   4.05
ttggggcttctcaagttaggggaggtttggctgggctcagcaggtgcaaggaagtacttc
ctacgacctgggcttcccatggatctgggacctctgcggggtcttcggtaggaagggtgc
agagagcacaggaagccccatccagctgaggaccctttctatggatgcccccacctccag
GCTCTACCCTGTGGGTCTGTTTTTGGAGCGAGTGGTGAGCTCAGACTTGGTGCTTCAGAA
CTACCACATCCCAGCTGGG
gtgagtgagccccacacccctcgagctgagaacctccctccccagtcattccctgatccc
tgctctgcaccgtccgcagacattggtacaggttttcctctactcgctgggtcgcaatgc
cgccttgttcccgaggcctgagcggtataatccccagcgctggctagacatcaggggctc

 1.08 Intr +   6317   6514  198  1  0  102   87   187 0.989  20.07
ctatggatgcccccacctccaggctctaccctgtgggtctgtttttggagcgagtggtga
gctcagacttggtgcttcagaactaccacatcccagctggggtgagtgagccccacaccc
ctcgagctgagaacctccctccccagtcattccctgatccctgctctgcaccgtccgcag
ACATTGGTACAGGTTTTCCTCTACTCGCTGGGTCGCAATGCCGCCTTGTTCCCGAGGCCT
GAGCGGTATAATCCCCAGCGCTGGCTAGACATCAGGGGCTCCGGCAGGAACTTCCACCAC
GTGCCCTTTGGCTTTGGCATGCGCCAGTGCCTCGGGCGGCGCCTGGCAGAGGCAGAGATG
CTGCTGCTGCTGCACCAC
gtaagcaggcctgggggcgggggcgggacctgggcagcagaggcgggacctgcacactgg
gggcggggcttgcatggtgtgattgacacctgggaacagtggatggggccttggttggtt
gaggtcggcgtgaccagggaggatctgtgctgagcaagacagggtaggatctgggtgagg

 1.09 Term +   7465   7572  108  0  0   79   49    49 0.766  -1.09
cctggccttgtccccagctccacctggccccttctccagcaagcagtgccctctggacag
cttgactctactcccagcgctggctccaggctcctcatgaggccatgcaagggtgctgtg
attttgtcccttgccttcctgcctagtctcacatgtccctgtccctctcgccctggccag
GGCCTCTGTGCAGACAGTGTCAGAGTCATTAAGCGGGATCCCAGCATCTCAGAGTCCAGT
CAAGTTCCCTCCTGCAGCCTGACCCCAGGCAGCTCGAGCATGCCCTGA
gctctctgaaagttgtcaccctggaatacgatcctgcagggtagactaaaaaggcccctg
tggtcacttatcctgacacattttcaagtgatacaactgagtctcgaggggcgtgtgttc
cccagctgatcatgtcagcctcatgccccaggcctcgtctttcatggaccaggtcttgtt

Predicted peptide sequence(s):


>CYP11B2_1|GENSCAN_predicted_peptide_1|501_aa
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHGLCADSVRVIKRDP
SISESSQVPSCSLTPGSSSMP