GENSCAN 1.0	Date run: 16-Jan-104	Time: 23:57:01

Sequence CEBPD_1 : 3694 bp : 60.48% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.02 PlyA -    272    267    6                              -0.45
 1.01 Sngl -    966    280  687  0  0   43   36   331 0.804  17.98
 1.00 Prom -   1042   1003   40                             -13.08

 2.01 Sngl +   1289   2098  810  1  0  105   42  1443 0.955 135.33
cggggcggctccggggggctcccagggcgcccccgccccttcccccgcggccccggggcg
cccccgcggtgccggagtcggggcggggcgtgcacgtcagccggggctagaaaaggcggc
ggggctgggcccagcgaggtgacagcctcgcttggacgcagagcccggcccgacgccgcc
ATGAGCGCCGCGCTCTTCAGCCTGGACGGCCCGGCGCGCGGCGCGCCCTGGCCTGCGGAG
CCTGCGCCCTTCTACGAACCGGGCCGGGCGGGCAAGCCGGGCCGCGGGGCCGAGCCAGGG
GCCCTAGGCGAGCCAGGCGCCGCCGCCCCCGCCATGTACGACGACGAGAGCGCCATCGAC
TTCAGCGCCTACATCGACTCCATGGCCGCCGTGCCCACCCTGGAGCTGTGCCACGACGAG
CTCTTCGCCGACCTCTTCAACAGCAATCACAAGGCGGGCGGCGCGGGGCCCCTGGAGCTT
CTTCCCGGCGGCCCCGCGCGCCCCTTGGGCCCGGGCCCTGCCGCTCCCCGCCTGCTCAAG
CGCGAGCCCGACTGGGGCGACGGCGACGCGCCCGGCTCGCTGTTGCCCGCGCAGGTGGCC
GCGTGCGCACAGACCGTGGTGAGCTTGGCGGCCGCAGGGCAGCCCACCCCGCCCACGTCG
CCGGAGCCGCCGCGCAGCAGCCCCAGGCAGACCCCCGCGCCCGGCCCCGCCCGGGAGAAG
AGCGCCGGCAAGAGGGGCCCGGACCGCGGCAGCCCCGAGTACCGGCAGCGGCGCGAGCGC
AACAACATCGCCGTGCGCAAGAGCCGCGACAAGGCCAAGCGGCGCAACCAGGAGATGCAG
CAGAAGTTGGTGGAGCTGTCGGCTGAGAACGAGAAGCTGCACCAGCGCGTGGAGCAGCTC
ACGCGGGACCTGGCCGGCCTCCGGCAGTTCTTCAAGCAGCTGCCCAGCCCGCCCTTCCTG
CCGGCCGCCGGGACAGCAGACTGCCGGTAA
cgcgcggccggggcgggagagactcagcaacgacccatacctcagacccgacggcccgga
gcggagcgcgccctgccctggcgcagccagagccgccgggtgcccgctgcagtttcttgg
gacataggagcgcaaagaagctacagcctggacttaccaccactaaactgcgagagaagc

Predicted peptide sequence(s):


>CEBPD_1|GENSCAN_predicted_peptide_1|228_aa
MTLPLPALQGLLFFLFVGLEPPRSSGLGVKSKPGLGRSARVPGRLLSPEGGGWRPVGEDP
RVQGRPPTVGTRVRPSPRASTVGPDAGRGVGDQTWGQRRPGRRGGLPAPHSGASGNPGRF
SLLSSEVPGPAGPGGRGPETRLLRPGRKADGTLSPKAEQMGETRSRHRVLRRLLEVRALR
PDATPRPRRPGRPPPAPAPAFLPGLRKQCHRVAASCVRPVFSSRLFPC

>CEBPD_1|GENSCAN_predicted_peptide_2|269_aa
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
TRDLAGLRQFFKQLPSPPFLPAAGTADCR