GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:29:20

Sequence ANK1_1 : 146796 bp : 50.28% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.05 Intr -    536    444   93  2  0   83  105    49 0.161   6.26
 1.04 Intr -   9451   9338  114  1  0   80   55    38 0.008   0.34
 1.03 Intr -  15169  15037  133  0  1   76   80    16 0.227   0.25
 1.02 Intr -  17547  17364  184  1  1   88   16    84 0.283   0.05
 1.01 Init -  19785  19683  103  0  1   48  115    62 0.709   5.30
 1.00 Prom -  21740  21701   40                              -5.56

 2.01 Init +  26023  26189  167  0  2   65   61   125 0.721   6.61
catttccccaacagcgatgctcctggtggctgacacactccccagggtggtcgctggctg
ggtctgagtggcgataaaccagcctgcctttctcggtaaagggtggagttcctggtaccc
acccttatcagtggtgcccagagtctctaggagcaggggcggctccttgggtgggtgagg
ATGGAACAGATGGAAGGAGGGTCAGGAGGAGAGCCCAACGGGTCAGCTGGCCACAGCCAG
CAGCAGGACACTGCAAGGGCAGCTGCGGACAGGGAGCGTGGGGGCACAACTGAGTCCACA
CATTGTTTCTTTGCTGCAGAGAATATGGGCATTGAAAAGGGTGCATT
gtaagcccaagaggtctgggtgcagggtagagctttgagatttcttgggatcctgatctt
gaccatggatgtttgaccctgggtaagcagtgatgaggccttgattttccagtgttgaag
caagatcagtgacaacccacacctctgggggagacattaacctttgacaaaagctttagt

 2.02 Intr +  27151  27173   23  1  2   86   66    31 0.583  -2.11
tctatactgagaacagcccactgcatcaagccaggagcgagctgggggtttaagtgctgc
atagtctatttcttccctttcttctctcccacatcatccctgcttggcatagctgcatgt
ggcccagaggacagaaccccacaggcgaggcctccagcttttcattatgcttgtctgcag
AGAGACCTGCAAGGAGACAGTAG
gtaaaatatttagcaagacgggaaaagcctgaagactccatgaagctacaggctagaaca
gtggcctgtgtctgccgagagtctttagccttttcttcagcccatcaattcctttctggt
ggtttgttttgatctcactagcaagttcttagcacactaaatgcctacgttaaaacgtgc

 2.03 Intr +  31343  31481  139  0  1   20  101   116 0.426   5.62
acccccttcgcagggcttggcagcaggtgcctgctctccggagagcgcttcgcattaact
ttcccatctgacataatcatggagagaaaatgaagagatcccattagcggcaggctggcg
ggcgggagagcgcagggccagggccgggccggggcgagtggagggcgcctgtatttttag
CCAGATGCCGCGTAACTTGCTGGCGCTCCCCGCGCCGCCCAGCAGATAACCGGGAGGGGG
AGCGGGAGCCGGGCTCGGATTTCAGCGCGGGCGCCGGACGATGGCAGCGCGACAGGGCAG
GTCCGGGCCAGACCCTGCG
gtgagtgcacgagctgtcgcggttgcccggccggggccggggcgcggggatcggggccgg
ggccggggccggggctctgcgtccgtcctgcgggttgtggctccgcgcccggctgcccgg
cgccaactttccccggcgggtgcgggtgcgcgcgctggggctgcccttctgctgccgagg

 2.04 Intr +  37046  37157  112  2  1   58   22   118 0.949   2.58
aggcagggatggaggaggttggctgggaggcagagcgaggaagcagcatttctgcaggcc
tggggttgtgggtgggggctgggaggtggtgtggggcagcacctgagtgtggagggagga
ccccctgtctggaaggctggagaaccctactgctgatgccctagggactccctgtttcag
TGGTGAAGACGTGAAGCGCTGCTTTGTGGAGGAGGATGAGAGTTCCATTTGGTCTTCGGC
TGTAGATTTGGAGTCTTCTGTGTTCAAGGGTGTTCAAGGGTGGTCATCACTA
gtgtgtgcatgagtttcccatggttgctgtaacaaatcgccacacacttagtggcttgac
actacggaaatgtgttctctcgctgtctggaggctggagatctaaattaaggcctccaca
gggacacactccctccagggcttcagggccttcttctatgagcctccacctcccagaggt

 2.05 Intr +  40686  40787  102  2  0  141  111    62 0.994  14.17
tgggtgtgaaggcagtccaaccaggggctctcaggctcctgtgcacacctggtgtcactg
tgggcaccagggtgccacatcagaggatgcaggggctgctgcgggggcctgggacttgaa
cggggtggagaagtcattaatacacccaggacactcaccgcctgttgtttttcctcacag
GCCGATGCTGCTACCAGCTTTCTGAGAGCAGCAAGATCAGGTAACTTGGACAAAGCTTTG
GATCACCTGCGGAATGGGGTAGATATTAACACCTGTAACCAG
gtaagtgggatggaggcaggcctgttgtctctgaagagtagctcttgcctgatgccattt
cctgagagctttgaaactgcctctattaaccttttctcagtggcctcaaaactcccccag
ggctcctgcctgtggaaggccctaaccttgctgtttccactcctgccgtggcccagggcc

 2.06 Intr +  52086  52181   96  2  0  107  105    22 0.447   6.01
gaccccactgcccttcttctaaaggtctgggtcttttttttttttttttaaagaatacca
agatctcgggcatagatgctctttctagtccataggagatattcttagatgctgaactgc
atttcagagtcccattctctcattaactcgagctcacacttcctcctccaccttccccag
GGCCCATCAGCCTCTGCAGTTGATTTGCTGCTGAGATGCAGGATTTCTCAGAGCACAGGG
CTGCTGCGAGTTCTGTACAATCAAAATAGAAAGAAG
gtgagctgaggttgattcatttccttgcagagctctaaaatcgttgtgcattcctttttc
ttaaggtaatgaaaaggattagagtgtttttcctcctcatgagtatccagcaaactgtga
atcctaagcgctacccaggcaggagggctaaagttagattgcaacaaagcaaacagagaa

 2.07 Intr +  55225  55302   78  0  0  100   31    63 0.187   1.55
ggttccagcccagtgctcggaattctttctagcctttcctctccccatgtttgtacagtc
cttcacacagcaggaggcctgaatgccactgatgcccgtcctccttaacatattcactga
cttgtttgctcagtgtgatgacaacctcccaaccactccattagctgtcctctttctcag
ACCCCAGACACGCTGCTGCCCATGCCCTGCAGGGCACCTCCCTGTTCACTGCCCTCTAAG
GCCGACATCTCCAGCTGG
gtggggagggaaggagaaggatgagaagggaagatgggaaagcactccttcagctttgat
ttcgtttctgttttggttgaaaatttgatgtaggcgatttgaggaaagaaatcaaaactt
atatagctctagtaatttttttgatgtgtctcagttcatttcctcttctagacaaactat

 2.08 Intr +  64754  64852   99  1  0  111   95    53 0.953   8.61
gcgtgaaggggaggctgggtggccctgccctgtgccccttccaacctctagacacactcc
actccttttctccagtgctgtgaacacctcagggctgggaaggggcctgggcccccactg
ggacgtgcagaaagcaccatttgactaaccatgcccttcccgcctctctgctctttacag
AATGGGTTGAATGGCTTGCATCTGGCTTCTAAGGAAGGCCATGTGAAAATGGTGGTTGAA
CTTCTGCACAAAGAAATCATTCTAGAAACGACAACCAAG
gtatgtctcacagggagtgggggagctttgcattgaaaattcaagtttgtgagtccttcc
ttagaaaccagtccttcatgagagaactcaggcatgcatctgaatttctcttatccttcc
aatcactttttagttctctgaatccctgaagctgcctgaaacagaccccatttccagaaa

 2.09 Intr +  66993  67073   81  2  0   44   62    81 0.542   0.93
tacggggtatttttttcccaaattctatgtcaaattccaattgttcccaccctgcttttc
gtgtggatgaagggtgagattattttctctgcacactcccacgtacctggctgtgagctg
tgtgccatctgacctgccccgcgtgtgccggagcggcgcctgccctggcgtgccttcaag
GGCTGCGGAAACACGAGGCTTCAGCGCTTCGACTGTTTCCGAATCTCCTCCCCAGGTTGT
GATTTTGCAAGTGAACACTTG
gtgtgtcttttttatttttagaaattttctaagccaacgtggctttggaataccatccag
agagagggggaaaaaaaggtggaactgaaaccgtgggctggggaagagtcacaacagatt
ggggactgtgatggggctcccaggcagcagaaagatgaaaaaaaaaaaagaagaaaaaga

 2.10 Intr +  70817  70915   99  1  0   80   95   183 0.981  18.51
actttcagtatgatttcaggatgtgcaatgggtcaagcacacacgtgtgtcctttctacc
ccttttggccatgaagaaagcccccgggtccctcaagcagcacctgtccacagacctttg
ctggtcccgtagcgggcccagtgggaaaccgcctctgttcccttcccccatgtgtttcag
AAGGGGAACACGGCCCTGCACATCGCTGCTCTAGCCGGGCAGGATGAGGTGGTCCGGGAG
CTTGTCAACTATGGAGCCAACGTCAACGCCCAGTCACAG
gtaatggctctctggtctggactagagggtgttgcctttccacaggtggttcctctttgc
tgctccctcgtgggtccattggcagccgtgttaacacacacactactgtggggcagggcc
tagatttctcaggagcatgtctctgagcagtggtgaaggtgtcctttattatttcgcatg

 2.11 Intr +  71475  71573   99  2  0  121  100    88 0.977  13.61
tggccttttgtaataatcccaggacgccagtcaccatgacaatgagtttccttaggaggg
gtcaggtgggaggaaatggaatgaagagagcgctgtcctccaggtgagaggacgttgtgc
tggtgtaggcctttcttaaattgcgggtggatgctaatgatgtcctctcttggtttacag
AAAGGTTTTACACCCCTGTACATGGCAGCACAAGAGAACCACTTGGAAGTGGTTAAGTTT
TTACTGGAAAATGGAGCTAACCAGAATGTAGCCACAGAA
gtaagtaccttggaaaaatgtcgtcaccaccagaagtctcccaggtgtacaaccttgctt
caggtgacacctacctgggatgtggcttggggtgcatccatgtcatgatggatgaccttc
aggtcgctgcactaatccagagtgctgtcaggttctgcaagggactaatgacaaagtcat

 2.12 Intr +  72877  73062  186  0  0   54  100   433 0.946  40.99
gggcttcagggaggagatggcatttaggctaaacttggcggatgaagagggctttggtgg
aggtaggtccctcaggctggggctgctgggagcataagcccgaggggcaagggtgtgtcc
cgtgtgaagggcggctggcgtcagacgagtcagagcaaagcattttcctcctctggccag
GACGGCTTCACGCCTCTGGCGGTAGCCCTGCAGCAGGGCCATGAGAACGTCGTCGCGCAC
CTCATCAACTACGGCACCAAGGGGAAGGTGCGCCTCCCGGCCCTGCACATCGCGGCCCGC
AACGACGACACGCGCACGGCTGCGGTGCTGCTGCAGAACGACCCCAACCCGGACGTGCTT
TCCAAG
gtgagggcgaggaggagggaggagccttgggccgcggacgcccgtgggctcagggggcac
cgcgcacgcccagcgacttcccaggcaggagaaccgagcgtgcagggcgggcagtgcgca
ctgagcgccctcaccccaggacgcagaggggcccctggacagccccgctctaaatccctg

 2.13 Intr +  74269  74367   99  0  0   88   91   174 0.993  18.01
ttttgaatacactgtgccataaagcctctcttgaccccctcaccaaatgttcccacccat
caaaatctcctttgtctgtaaagtcctgttgccccacctgagtttcctgcatcccagggc
tgattctgagatagaagtaaatcacatataacaagtttctccccctctgttgtgccccag
ACGGGATTCACGCCCCTGCACATTGCGGCTCACTACGAGAACCTCAACGTGGCCCAGTTG
CTCCTCAACAGAGGAGCCAGCGTCAATTTCACACCACAG
gtaaccctggggcacgtgcgccctcactgtccgggggcttggggctggcagttgctcctg
cctcggcaccatgggtttcatcccagtggcagaagtgcctgtgggttaaacagccctgct
gtctggtcgggctccttgctggcaggtttctgatcatctaccccccagtttccacctgct

 2.14 Intr +  75190  75288   99  0  0  126   98   149 0.999  20.01
cgtctcaaaaaaaaaaaaaaataaaaaataaaaaaaaataaaatatcttaggccagaaat
gccctgacaacgctgttgcaggcctggggactgggggctggggacaaggggagcgggtgc
acagcagctgcattccagggaaggatgacgcgccctgaccgtcctgcttcctcccttcag
AACGGCATCACGCCACTGCACATCGCCTCCCGCAGGGGCAACGTGATCATGGTGCGGCTG
CTGCTGGATCGGGGAGCCCAGATAGAAACCAAGACCAAG
gtgggtgccagcaggtgctgtagccaggcagggggagggaggtcccccctcacaagcctc
acccagagcagcgggcccttggtgacctagttagggatgcaccaccagcctcccggagcc
gcctgcagcagtattctgggcagtgccgcgtgcagtgggaggcaatagtaaaactgtgct

 2.15 Intr +  75600  75698   99  2  0   83   93   106 0.999  10.91
tattctgggcagtgccgcgtgcagtgggaggcaatagtaaaactgtgctgaggtcgagct
ggtgcttgaggaaacgtcagcacttgcgtgggctgggatgatgccataggcagtcttctc
tccaaatggcctctgatagctgccttttgggctttctgtttttgactctgtcttttaaag
GACGAATTGACACCTCTCCACTGTGCAGCTCGAAATGGGCACGTGCGAATCTCAGAGATC
CTGCTGGACCACGGGGCACCAATCCAAGCCAAAACCAAG
gtgtgtacttccttcctgtcaggcgcattttctagacagggctccaggtccaacagacct
ggcatcaaatcctatttctgtaaaacagagatgctaatactactagatgagatagcacct
ttgacatttattacaaggcctatcacgtaggagactctcagtgtagctctaatgcctaac

 2.16 Intr +  78965  79162  198  1  0   86  105   178 0.906  18.85
agaatgtctgtggtcagagaccggcaggagcgtggaggccagggtgagccaagctccctc
cagagacttgtggaaacattgtgtagggaagaagtagggagtgacgttggaatcgtcctg
aatctccatgctcggtccccagaagactttgtgattgcttgtgttttcctctttacccag
AACGGCCTGTCCCCAATTCACATGGCGGCTCAGGGAGACCACCTCGACTGTGTCCGGCTC
CTGTTGCAATACGACGCAGAGATAGACGACATCACCCTGGACCACCTGACCCCACTCCAC
GTGGCTGCCCACTGTGGACACCACAGGGTGGCTAAGGTCCTTCTGGATAAAGGGGCCAAA
CCCAACTCCAGAGCCCTG
gtgagtgggggtgctgctggagaaggtgcagagtggcagggcaggctgggggcaggagca
gagaggcatggctgggcctgtgggaagggcggcaggtgcccggagctccccagattcgag
gcctgagcagtggggtgtgacagcactggatggtgggggcctggtgtgcacccctcctgc

 2.17 Intr +  80619  80717   99  2  0   69   75   193 0.943  16.41
atttgcattaattgacattataagactaatcaattggcattaattcgttgattggtctat
gggcatctgctggtggcctgggcagcagctgccttttagagcagccaggtggtcttctgg
gcgttccttgggcccgtgtgtaagctcctgcttgtctgtctccctttgtgtgggctgcag
AATGGCTTTACCCCCTTACACATCGCCTGCAAAAAGAACCACGTCCGTGTCATGGAGCTG
CTGCTGAAGACGGGAGCCTCGATCGACGCGGTCACCGAG
gtaggagagactgcagaggagcctgggggcaggcctgtggtctcccccgacccaccttct
ccaagagtcgctctttgtagctttgtatggctgcaggggtgtgtgtgtctgcaagtctgg
actgctggaaggaatgaatcaggggtgactaagacaagggaacatgagtcaagtctcatg

 2.18 Intr +  81121  81219   99  0  0   82   91   127 0.981  12.71
gggcacgacttgcccacagtaatttttttctccaaccattttcttggaagcaaacccacc
tcatatagctcccttttcttggaaaatcatttgtgaaagcgttagatactgtcaggttct
ctcttcttcaggggagcggaaagactcccacttatcggactctgcctttgtctgtttcag
TCTGGCCTGACACCTCTCCACGTGGCCTCCTTCATGGGGCACCTTCCCATCGTGAAGAAC
CTCCTGCAGCGGGGGGCGTCGCCCAACGTCTCCAACGTG
gtaagccctcaggcaggcaggggcttgctcccctagaccaagagctcagagggcagcttt
caccagtgctcccagtcctactctctggggacagagctacgattcccagaacagccaatg
cttcagactgggggaggacatccctgtgtactgacgctttctggattaaatttctcacac

 2.19 Intr +  81772  81870   99  0  0   74  113    93 0.999  10.71
cacacatacatgctcatgcacacatgcacacataccaggctaaagagctgcctgctgggg
caactccacctcttggacaaaaacccaccaagccactccagactgcacttcctagctctg
tgtgtgccgttttggacagcaggcatgtatgaacagttctataattttgttattttatag
AAAGTGGAGACCCCGCTACACATGGCAGCCAGAGCCGGGCACACGGAAGTGGCCAAATAT
TTACTCCAGAACAAAGCCAAAGTCAATGCCAAGGCCAAG
gtgagtagtgaaggcaggaagggaagggtttcagatgtgagcagttccagcactgtgcag
agaacccatcctcattccaggcggggctgcagtgctgtggcctggggatcacttttcatc
ctgatcaggtcactctgagcgcccagattctgctttgcagggggtttgagaagaccaggg

 2.20 Intr +  82974  83171  198  2  0   61   87   231 0.999  19.85
gcatattggttcctgtaactcagagacttgattcgaatcctgactcttcatcttcttagc
tgtgtgaccttgagaaggtcacttgccctctctgggccctgccttgcttctctgtaagat
gaaaagttggatttggtaacattagcgtttcttcttctttgttttcccttcggggtccag
GATGACCAGACCCCACTTCACTGTGCAGCTCGCATCGGCCACACAAACATGGTGAAGCTC
CTGCTGGAAAATAACGCCAACCCCAACCTGGCCACCACCGCCGGGCACACCCCCCTGCAC
ATTGCAGCCCGTGAGGGCCATGTGGAAACAGTCCTGGCCCTTCTGGAAAAGGAAGCATCC
CAGGCCTGCATGACCAAG
gtacagcctcccgcctcgtggtctaaggaagcaacaggctcactcagccaggcctggagc
tcggaggggaattcctgcctggttctctttgtcacctcaatgatgctgcaagcagctgga
agggtcgtcacactcagggctggccaccacctgcaagccgatgtgtctccatccttcccc

 2.21 Intr +  83749  83847   99  0  0   81   87   188 0.983  18.31
tgcagggatgcctgccaagtcctgaggtcttcggcctcccagagggctcaaaaatggctg
tgcctttgctttcattggcctctccatgccagcggaggtgcagcctcctttgctgtgggc
cctttctccagggaggacagccctggggccccaaggtcctgacagcctgtttctcctcag
AAAGGATTTACCCCTCTGCACGTGGCGGCCAAGTACGGGAAGGTGCGGGTGGCAGAGCTG
CTGCTGGAGCGGGACGCACACCCGAATGCTGCCGGAAAA
gtgagtttgaaccctgccctcccctgcagctctcaggttagaggcaaggacagaggatgg
acatcagcacttgcagattccatctcttgcctgtgttgttcatcttttttttctttgaga
cagggtctcgctctgttgcccaggctggagtgcagtggtgccatcacaactcactacaat

 2.22 Intr +  84569  84667   99  1  0  122   82   181 0.999  21.21
tcccacagggctctgggtcctgccgatgacattctgtcatgactccaagttaagactggc
ctgggaaagattttaaacaggattttactgtataaaataggtgctcccatgcctaaaggg
agtcctgggagaaagtccgtgggagtgacagccggcctcttttgtctttgtcccctgcag
AATGGCCTGACCCCCCTGCACGTGGCCGTCCATCACAACAACCTGGACATCGTCAAGCTG
CTGCTTCCCCGGGGCGGCTCCCCGCACAGCCCTGCCTGG
gtaaggcccgcccctctccccagctgcccctggagagcaggtcacctgctaccttccagt
ccctcagggaggggggtttccacagcagcccaagggttttgcgttctgttgctattttta
cctcagaaatcacgcctcactttcccacatgttacctgccctgtaatcacgctattcagg

 2.23 Intr +  89848  90045  198  0  0   96  102   289 0.999  30.65
gtctccaaatcaaatggattttgtttgtttgtttgtttacctaaattgctcctgggtgat
gccagccctgctcactgggtgtccagccggccaagaaccagactcagcccctgcttgtgt
gttgatattgtcagctcagcattcctgtaaccaggctctgggcggcttcttctgtttcag
AATGGCTACACCCCTTTGCACATCGCTGCCAAGCAGAACCAGGTGGAGGTGGCCCGTAGT
CTGCTGCAGTATGGGGGCTCAGCAAACGCCGAGTCGGTGCAAGGTGTGACGCCCCTTCAC
CTGGCCGCCCAGGAGGGCCACGCAGAGATGGTGGCTCTGCTGCTCTCGAAACAAGCCAAT
GGCAACCTGGGGAACAAG
gtaggcatggtgtcttcggatctgccctggagtgctggataacaacgtgtggtgtcttca
tattgagcatctatgtgtgcccaggttctgagttaggggtgtgtgtgtgtaatccttgga
acagccctgcgtacatttcaccttcattttataaatgaataaacagagtcagaaaggttg

 2.24 Intr +  92582  92680   99  1  0   78   90    94 0.995   8.91
gtaaccaccttactttttagataaggacattggggcccagaacaggaagagctttgcctg
gagccaaataactagttggtgactgcaaagttagcttcagctcccagacctcagagctct
ttacttgtggcctggaattctttacttgatagaaggtgatgaacgtctttttctttgcag
AGCGGACTCACTCCCCTCCATCTGGTAGCACAAGAAGGCCACGTTCCAGTGGCAGATGTG
CTGATCAAACACGGCGTCATGGTGGACGCCACCACCCGG
gtaaggcaggcagccggaacttcagtctgtgtggactccttgctcacacttcagaattga
atcttccacagagctttgaaaccccaaagacccagtgggacattcttctctgccacttcc
tagggctggcagtggagtttgaaaacactactcctaattacctgactttcccattgggga

 2.25 Intr +  94351  94449   99  0  0  107   87   148 0.975  16.91
ggtctcccacaagcatctcagcctggtggtctctgcccagcagcagccattcagcttgtc
aatgtcagccttcaaggggctccctgtccgttctctctttgaatcagctgctttgggaag
gatttcatgtgatgcccagctcaggacagctccggtcactccttctcatctgcttttcag
ATGGGCTACACTCCCCTCCATGTGGCCAGTCACTATGGAAACATCAAGCTGGTGAAGTTT
CTGCTGCAGCACCAGGCAGATGTCAATGCCAAGACCAAG
gtacaggggtgccccagccccgactcctgcactgacccttctccatgccacatcagggta
aagccagagctgctctgggagcactagggttttgaccatggaccctgaaggaagaaaggg
ggaaaatgcatttcattaatgtcccacttcgaagatgggcaggcactatcatgtgtaggc

 2.26 Intr +  94684  94782   99  0  0   90  109    69 0.981   9.51
agggtaaagccagagctgctctgggagcactagggttttgaccatggaccctgaaggaag
aaagggggaaaatgcatttcattaatgtcccacttcgaagatgggcaggcactatcatgt
gtaggcaggtctctgtctagtggctggctaaccctgcctaaatgtctgctcactttgcag
CTAGGATACAGCCCCCTGCACCAGGCAGCCCAGCAGGGACACACAGACATCGTGACTCTG
CTTCTGAAAAACGGTGCTTCCCCAAACGAGGTCAGCTCG
gtgagtacactctctctcctgagtttagaaaactgctccccatggcagcagccctgtgtg
aactcccctaaccgtagaggttaatgcacgtgtctagggcctggacggggccgcagcacc
ctaaagccacagctaccttgggtaccctggggatggggtgctgtgatcagttcctctttc

 2.27 Intr +  96679  96771   93  0  0  115   68   155 0.999  16.36
gctaacacacatctaggcacacacacgtgcagggatctctttctgggccccacggtgacg
tctgtccactcaggtcctcctgaacaactagaaggtgaactcgatctgtgtctagggagc
cagccccgcctcctagactccatcccctgtctgactgcacccgggctgctctttccccag
GATGGAACCACACCTCTGGCCATAGCCAAGCGCTTGGGCTACATTTCTGTCACCGACGTG
CTCAAGGTCGTCACGGATGAAACCAGTTTCGTG
gtatgtctgcctctcccccgcacccaccccagacacactcagcctggcgcacaggcgtgc
ctggggttactctggaagtggggtgcgttctggggctccgggacgcgggtcggaggcgcc
gcgcccgacgggtgggagcttgtcctccttccagcggggctgtgctgccacctagcggcc

 2.28 Intr +  97201  97273   73  0  1   87   92   112 0.999  10.48
cagttttcccgggtcccgtccccgtggttcctgcccggcagcttccaggctgagcgcctc
ctccgtctgtttttcttcatttgtgggaaaccccacaggcatgaccagggaaccgctggg
ctggtaaaaaatgtgtgcggctctagtttgggttgaattatctgctttttctcgttttag
TTAGTCAGTGATAAGCATCGAATGAGTTTCCCTGAGACAGTTGATGAGATCCTGGATGTC
TCGGAAGATGAAG
gtaacgttggggtaaagagctcaggctggtggggacagaggggctccgggcaccctccaa
gggggcttcctgccacctgccggctttgtccccttacaacacgcccaagcactatagatg
gacactgaaactggggagacctggtttttataactgttgtctactatcaaaaatactgct

 2.29 Intr +  99275  99371   97  0  1  103   39   142 0.840   9.87
cccagagctggaggaccaggactgggcaaagacattgctcccagtctccttgcagcatca
agaccttccccactcctcaggagcaagcccccagaggcggagcgggaacagagctttttt
aaaaaaagagggactcttcttcctctaccccgtcgctcacttgagctcttgctgtttcag
GGGAAGAACTCATCAGCTTCAAGGCTGAGAGGCGGGATTCCAGGGATGTTGATGAAGAGA
AGGAGCTGCTGGATTTTGTGCCGAAGCTAGACCAAGT
gtgagcagtgctcccgggagggtccccgggggtgccgagatgcaaccctgtggctcagag
cagggattccagagggaggaaggacacagcaggccaggcgctgggctcgctgcccgcaga
gagagacggtttgcaccttaggatgagctagctctgcaccctagccactagggcaggcgg

 2.30 Intr + 100702 100780   79  1  1   81   94    28 0.867   2.25
tgcaggttggagtcattggggaggacttcatggaggaggaggcggtccttccaccaggtt
gtgaagcgcagtcaggctctggagtggaaagccggagggagaggcttggaggcaagagga
agaggagctgtgtgcacatgtggatcagccctgtgatgttctggtgttcttggcacgcag
GGTGGAATCTCCAGCCATCCCCAGGATTCCCTGTGCCATGCCTGAGACAGTGGTGATCAG
GTCAGAAGAGCAGGAGCAG
gtgagaagctccttctctgtggtttccccacatggagggcatgaaaaccctgggacagtg
attgttgaggggtggcctgtacgtagcacaataggcactaatagctcacatgccactcac
tgtccaactggcattccacgcttggacgcctcataatggtgcaacattggtggcgctggg

 2.31 Intr + 102050 102147   98  1  2   66   96   170 0.988  14.41
tgcttccttttagacctcaggacggccttgtctgacagggcggtggggtcccgtgggagc
actttctccacgtggcacctggtttctagcggcaaggttcttccaagcctccacgccctg
gcacggcatccagctggcccgggaggaggtgggacaggaggaccctttctctctcctcag
GCATCTAAAGAGTATGATGAGGACTCCCTCATCCCCAGCAGCCCGGCCACCGAGACCTCA
GACAACATCAGCCCGGTGGCCAGCCCGGTGCATACAGG
gtgagtggcgggcgcagggctcggggactcctgtctccatctccgagaggggatgcagaa
gcccaacgtgcatctgccccactcctaggtttctggtgagcttcatggttgacgcccggg
gtggttccatgagaggaagtcgccacaacggcctgcgagtggtgatcccgccacggacgt

 2.32 Intr + 102236 102460  225  2  0   64   83   275 0.999  21.70
aaagagtatgatgaggactccctcatccccagcagcccggccaccgagacctcagacaac
atcagcccggtggccagcccggtgcatacagggtgagtggcgggcgcagggctcggggac
tcctgtctccatctccgagaggggatgcagaagcccaacgtgcatctgccccactcctag
GTTTCTGGTGAGCTTCATGGTTGACGCCCGGGGTGGTTCCATGAGAGGAAGTCGCCACAA
CGGCCTGCGAGTGGTGATCCCGCCACGGACGTGCGCAGCGCCCACCCGCATCACCTGCCG
CCTGGTCAAGCCCCAGAAGCTCAGCACGCCGCCCCCACTGGCCGAGGAGGAGGGCCTGGC
CAGCAGGATCATAGCACTGGGGCCCACGGGGGCACAGTTCCTGAG
gtgagcttgcgcgggcagcccgtgttctcccctgtccctgtgccacggaggccacgccat
ttccatctgtcctgatggggaaacagaactgggtgcccctcccctttccctgacttttcc
tgacacacgaaggtgtccatagccctgagagggcttacaactctcagatctcaggtcggg

 2.33 Intr + 103492 103646  155  1  2   74   97   299 0.992  29.12
gaagccctggggaacctccccatgggtctggtccacttagagacctgcctgcaggtgggg
cctccacgtggctgcggaagtgccttatccatctgggtgggagccggcagccccatccct
ccctgtgccctgcctgccttgtatgagcacctccccaccaccactgtgtccttgcctcag
CCCTGTAATCGTGGAGATCCCGCACTTTGCCTCCCATGGCCGTGGAGACCGCGAGCTCGT
GGTTCTGAGGAGCGAAAACGGCTCCGTGTGGAAGGAGCACAGGAGCCGCTATGGAGAGAG
CTACCTGGATCAGATCCTCAACGGGATGGACGAAG
gtaggggcgggggatcccagggctgggtcccctccttgcggaagaggggtttgagttgca
ccttaaaggtggtctttgagggccacctgaagtttgggaagccccaagaggctgagaatg
gcctggtgtggacaagccctgggtccccaggatgtgtgagaggatgctcagcggctgcct

 2.34 Intr + 104020 104231  212  2  2   41   61   396 0.997  30.83
ctctgctgggcctctgggcctgggcacttcttctggccacttcttctggccactatgccg
cccggcacctggggagggtgtgtgcactgggtcttggggacaaggagactctggggcccc
tggaagtcctgaacctgtgcctgatgtgaccggggtggtggcctgtgtgtgtgattccag
AGCTGGGGAGCCTGGAGGAGCTAGAGAAGAAGAGGGTGTGCCGAATCATCACCACCGACT
TCCCGCTGTACTTCGTGATCATGTCACGGCTCTGCCAGGACTACGACACCATCGGTCCCG
AAGGGGGCTCCCTGAAGAGCAAGCTGGTGCCCCTGGTACAGGCAACGTTCCCGGAGAATG
CCGTCACCAAGAGAGTGAAGCTGGCTCTGCAG
gtgacagccctcctccccgccaggtcctgggggtggactgaactccaggcctccgggaag
gccaccctcttccccaggacatccccacacttttgtctggtgctttgaaatgccacagtg
gagatctgagtttaaagctcaaaggagagttaagtgggaaggggtgaggtggaagctccc

 2.35 Intr + 104721 104925  205  2  1  106   77   222 0.993  21.67
gcagaggagaaggggagaaagggctcaggaaggcaagctccaccgtgtcggttctgtggt
ccaacagcagggcgggaccccgtgcactgacggccactctcaccaggcatggagctgcct
cccgtctgattagcccctctcctgcttgggcctgagtgtcctgcctctgtcatttcacag
GCCCAGCCTGTCCCGGATGAGCTTGTCACTAAGCTCCTGGGCAACCAGGCCACATTCAGC
CCCATTGTCACCGTGGAGCCCCGGCGCCGGAAGTTCCACCGCCCCATTGGGCTTCGGATC
CCACTACCTCCTTCCTGGACCGACAACCCGAGGGACAGCGGGGAGGGAGACACCACCAGC
CTGCGCCTGCTTTGCAGCGTCATTG
gtgagaggggcccctgcctcgcttctgttctcggctgctgcagtgcgtctggaacacagt
aggggggtgactcgagaaggcgaggccagcaatccccttagtttttgttgacttccccgg
gagtgaggtgctcttccaagagatggaaggatgatgtatctgcataaaagtccatgccca

 2.36 Intr + 105622 105718   97  2  1   97   94   145 0.999  15.07
gaggaggggcatgcaggttgctaggaggaagagcagcggggtgagggtagggtgcccagg
gctgcagacaaagtgagcttcacccagtctcaccttgcacaccacggccttagcatttta
gtaagctccatgcttacatcctgaagactgtccccagccccatttctgccgctgttacag
GAGGAACAGACCAAGCCCAGTGGGAAGACATAACAGGAACCACCAAACTTGTATATGCCA
ACGAGTGCGCCAACTTCACCACCAATGTCTCTGCCAG
gtgagacgaggccagcccagcccagtattgtgtgggccgtcctcaggctctatgctgccg
tccaggcctgaggctgaggctccctcactgtcccctccatgtggaagcctccgtgaccac
aggtgtggcaatagtagccatggtatggctcacgggctgctcccgtctggatggaaagga

 2.37 Intr + 105947 106175  229  2  1   57   77   383 0.784  31.97
tctatgctgccgtccaggcctgaggctgaggctccctcactgtcccctccatgtggaagc
ctccgtgaccacaggtgtggcaatagtagccatggtatggctcacgggctgctcccgtct
ggatggaaaggatgctctctgttgggcacttgggaacacataactcgccctactttttag
GTTTTGGCTGTCGGACTGTCCTCGGACTGCTGAGGCTGTGAACTTTGCCACCCTGCTGTA
CAAAGAGCTCACTGCAGTGCCCTACATGGCCAAATTCGTCATCTTTGCCAAGATGAATGA
CCCCCGAGAGGGGCGCCTGCGCTGCTACTGCATGACAGATGATAAAGTGGACAAGACCCT
GGAGCAGCATGAGAACTTCGTGGAGGTGGCCCGGAGCAGGGACATAGAG
gtaacagggctgggccctgcaccgcctctgggacaaaccgtcctgccgttttctccagaa
caccattaccaggtgcaggcaggcagtcctccctctgtagacgaggggctccacagctgt
ctgtctttgagacccctcttgagaagcatcttagagaagcttcaggaaaggagagagatg

 2.38 Intr + 108224 108349  126  1  0  138   50   156 0.998  17.68
ttgatcacaattttggaaataaagcctttcccaaaacaaacagtggatttctcagcacac
acccgcatgcctcttgctgaggcagggtgtgtcttggagagggaaggaccgaaggtggaa
ggagggacatctgggcccttctctccctgacaagctgtatctgcttttcctctcctgcag
GTGTTGGAAGGAATGTCCCTGTTTGCAGAACTCTCTGGGAACCTGGTGCCTGTGAAGAAA
GCTGCCCAGCAGCGGAGCTTCCACTTCCAGTCATTTCGGGAGAACCGTCTGGCCATGCCT
GTAAAG
gtgccggcaccctctggctgagttctcctctgggtctagaaagttggggaggcagaattc
cctaaaccagacagccgggtggcctagaaaagggcccctgaattctcctttgtgtgattg
agtttaggtgagggacagcagtcgagagccgggagggtccctgtcgtttctgcgcaaggc

 2.39 Intr + 108477 108596  120  2  0   13  105   157 0.997  10.59
ggagcttccacttccagtcatttcgggagaaccgtctggccatgcctgtaaaggtgccgg
caccctctggctgagttctcctctgggtctagaaagttggggaggcagaattccctaaac
cagacagccgggtggcctagaaaagggcccctgaattctcctttgtgtgattgagtttag
GTGAGGGACAGCAGTCGAGAGCCGGGAGGGTCCCTGTCGTTTCTGCGCAAGGCGATGAAG
TACGAGGACACCCAGCACATTCTCTGCCACCTGAACATCACCATGCCCCCCTGCGCCAAG

gtgagctggcacctgccgaggagccttggcccgagacggcttccctgtaggaggtcccca
aacagaccccaggtccagcacttccaaggggcttcttcctggtggaagcttagagtcccc
cgaggcatgcaaaggtgctgagctctcctccacatgctcatgttgtggcctggcggggag

 2.40 Intr + 110234 110312   79  1  1  106   96    57 0.922   7.42
tcccttcactcccactcctcccatgtgttactctttgtgttaagtccctgaagaaacgga
ctgattgtttaccaggactggggtcagccttccacacccctgcagcataggagctcagat
cactttctctgggaaggtggggagagtccaaaacccaaagcaccctttcttcttctgcag
GGAAGTGGAGCCGAAGATAGGAGAAGGACCCCGACGCCCCTGGCCCTGCGATACAGCATT
CTCAGTGAGTCCACACCAG
gtacggcctctgtgtgatgatgcatgcttgctcccttcccaagaagggtgggcgtgagct
catctccccgcagccctgtgagggttctgctgaggtgccgctcgctcagccagttccaaa
agcagctgcagagctgactcgggtcttcccctgatcttgcagagagtctagacaatcacc

 2.41 Intr + 110593 110667   75  2  0  118  109    23 0.992   6.89
ctcgctcagccagttccaaaagcagctgcagagctgactcgggtcttcccctgatcttgc
agagagtctagacaatcaccccagtgcacacggaagccacatccatcacaggccgtgtcc
tcaggcctgtcaactgtgtcctgccctggctactaaatgaaatctaatgcttctccccag
GTTCTCTCAGTGGGACAGAGCAGGCAGAGATGAAGATGGCTGTTATCTCAGAGCACCTCG
GTCTCAGCTGGGCAG
gtgagtggggaattgggggcagaaaagcactttgtccatctcacctaccctcttcccctg
taatgagcaatgaatgaggcatttctaaccctccttttatcacccgtgggttatctgatt
tgtgattgtctgagctgggtctgctgcccaagccacaccattggctgcccatgaaggggg

 2.42 Intr + 112540 112671  132  2  0   85   24   221 0.997  16.02
atttcataaggaatttcttgataagaaggaagaccaaacccacagggaggctgcctcaga
gctccctgtgctccccactgggtccccccacgccccagtgcccacccagcctgtgtgctg
gaggccccctgctgttggtgagctggaggctcacatctgctgttggttctttgcttgcag
AGTTGGCCCGGGAGCTGCAGTTCAGTGTGGAAGACATCAACAGGATCCGAGTGGAAAATC
CCAACTCCCTGTTGGAGCAGAGTGTGGCCTTGCTGAACCTCTGGGTCATCCGTGAAGGCC
AAAACGCAAACA
gtcagtaccgtcccactgaggaagcctgtcctaggacctcctccccaccaaactagttct
tccttcaaattccattcatgacactggcctctggagtcagtctgtctctgtctctctcac
acacactcacgcaccactcgcatcaggaggtcttccaggcagtcctgccagaaggcatga

 2.43 Intr + 114133 114279  147  2  0  105  101   181 0.995  21.31
gaagtgtaaaaagtattctccccagaggaagtttgttttgactctaataaaagagggtgc
ctccaccttctgaaaaaaattatctcctttctccatcttcatcctggccccattttctga
gcccatgtgatcctcgctcaccggcctggagtaacgtgcatctctcttctgcgcccacag
TGGAGAATCTGTACACAGCCCTGCAGAGCATTGACCGTGGCGAGATCGTGAACATGCTGG
AGGGTTCCGGCCGACAGAGCCGCAACTTGAAGCCAGACAGGCGGCACACCGACCGCGACT
ACTCGCTGTCACCCTCCCAGATGAATG
gtgagtgtcacctggaccagatggggactgagccggagccctgccctacaggcatcagca
ccaataaccccttcccacaatacgtcatccctcaaagcccgctctgcctcccattggtgg
gaggtctggtttgtcagcaacaagttcctcctttccggggaagcagaggcgaaggagaga

 2.44 Term + 114377 114576  200  0  2   54   54   152 0.905   5.96
ttccggccgacagagccgcaacttgaagccagacaggcggcacaccgaccgcgactactc
gctgtcaccctcccagatgaatggtgagtgtcacctggaccagatggggactgagccgga
gccctgccctacaggcatcagcaccaataaccccttcccacaatacgtcatccctcaaag
CCCGCTCTGCCTCCCATTGGTGGGAGGTCTGGTTTGTCAGCAACAAGTTCCTCCTTTCCG
GGGAAGCAGAGGCGAAGGAGAGAGAGATGGCTGCTCCTGTGCAGGTGGGCATCGCCTCCG
CCTTAGCCTTTGCAGCCCTGCAGAATGGCCCCCAGGCCCTTGCCATCAGCAACTGCGTCC
CCACAGGGCGTGGTGTATGA
gaaaaagctgagtcagaggcctctagctagagactgcccctacacagctgcagactttcc
ggtagctctttgcaaggcgtgggccctctttggggtgtcagtgtccccatctgtaaaaca
gtcagtggttgggaagcagagggcatggagattcctggcccaaggtctagtgcagtttaa

 3.01 Init + 122591 122808  218  1  2   64   99    56 0.438   2.46
atagattcgaacagacttttcacccagaatatatacacatggcaaataagcacatgaaaa
tatgctcaacatcattagtgatttgggaaatacaaattaaaactataaggaggtaccacc
acatacctaaaagaatggttaaaattaaaaaggctggccatatcaagtgttggtgaggat
ATGGGGGAACTGGAACTCTCATACACCACTGGTGGGAATGCAAAATGGTACAACCACTTG
ATCATTTCTGACAAAGTTAAACATATACCTACTGTACAATCAAGTCATTCCATTCCTAGC
TATTTACCCAAGAGAAAAGAAAGCATTATGTCCATACAGACTAGCATCTTTACTTGTAAT
AGCCACAAACTGGAAGCAGCCCAAATGTCCATTGGCAG
gtaaataaatttacaaactgtgatatatccttccaaagggctatggcttagcaacagaaa
taaattattgatacatgcatcagcatggatgaaacccaaattgactacgttgagtgaaag
aagccaggctttaaagaaagagagagtgcatactgtatgaatccgtttatgtaaaatcct

 3.02 Intr + 123986 124098  113  2  2  101   32    34 0.421  -0.88
gtcctgcttttgtatatgtggagggttttctatgaagggtttgaaggccatggccctggt
cagctatataattcctcaagtcacagtttcatgtacagtgacttggagttcagttcatgg
taagatgtgacccacccatttcacctactcttcccactccttcctccttgttcttcctag
TTTGGCCAGAGCTAAAAGGGGTTTCCCTCAGTCTCTGCCGCTGTGCAGCCCTTCTCCCAA
CCACCCCACCTTCACGGGCTCATCCTCCCCGCTCATTTGGGACCTGGAACCAA
gtaggcttgcagggaagaaaacttccctgggagattaagagaatgcatgcggagtacaca
gcatggctccgggcacgttgaacacacaggtacatgttagcaattgcagttccactgaat
gtgcctgaggtctttctgttccagctgctgggtcctctcacacacctggagagctcttca

 3.03 Intr + 125911 126469  559  2  1   75  110   456 0.569  38.39
cagccacaaggcctgagcattgggcctggagcttggaaagcccccaacccaccccgaatg
tgcatgcatctctgtggccgcacccgcatgtgtgtgttcgtgcgtgtgcgtggacctgca
cgtgaatgggtgggacaggaatcactgctggagcatgttgccctctgtctgcccatccag
GTTACTCCTCACTGCAGGACGAGCTGCTGTCCCCTGCCTCCCTGGGCTGTGCACTTTCCT
CTCCGCTACGTGCAGACCAGTACTGGAATGAGGTGGCCGTCCTAGACGCCATCCCCTTGG
CGGCCACGGAGCATGACACCATGCTGGAGATGTCTGACATGCAGGTGTGGTCTGCGGGCC
TCACGCCTTCTCTGGTCACTGCTGAGGACTCCTCTCTGGAGTGTAGCAAGGCTGAGGACT
CTGATGCCACAGGTCACGAGTGGAAGTTGGAGGGGGCACTCTCAGAGGAACCGCGGGGCC
CCGAGTTGGGCTCTCTGGAACTTGTGGAGGACGACACAGTGGATTCAGATGCCACAAATG
GCCTTATCGATTTGCTTGAACAGGAGGAAGGTCAGAGGTCAGAAGAGAAGCTGCCAGGTT
CTAAGAGGCAGGATGACGCGACAGGTGCAGGGCAGGACTCAGAGAATGAAGTGTCTCTTG
TTTCAGGCCATCAGAGGGGGCAAGCCCGAATCACACATTCCCCCACCGTGAGTCAGGTGA
CGGAGAGGAGTCAGGACAG
gtaagagcttgactgtgggagcagggtccctttttgtcttctgggctcctgggtaagatt
atgcctggcagtgaggacagaggtgtcgatgccaaccctgaccctgggttctaattgcac
aggagcacatacattcagtctggcagatgccatatataagagcataggtgccatctgcaa

 3.04 Intr + 130259 130556  298  2  1   75   94   297 0.961  25.88
agtgaggtgagcaatgtgctcatgcgcccctgacctttggagggatgggaggacggtctg
tgtccttgatgagccagagctctgggtggggagagtgtctaaaaggaatgagactgatgg
gtgaccaggtgtcttttctctctccccggccggccatctgctgcttcttctggaccccag
ACTGCAGGACTGGGATGCAGACGGCTCGATTGTCTCATACCTGCAAGATGCTGCACAAGG
TTCCTGGCAAGAGGAGGTCACGCAAGGTCCACACTCATTCCAGGGAACAAGTACCATGAC
TGAAGGGCTAGAGCCCGGTGGATCTCAGGAGTACGAGAAGGTCCTGGTGTCTGTAAGTGA
GCACACGTGGACAGAACAGCCCGAGGCTGAGAGCTCCCAGGCCGACAGGGACCGGAGGCA
GCAAGGCCAAGAAGAGCAGGTGCAGGAGGCCAAGAACACCTTCACCCAAGTGGTGCAG
gtgagagcccgaggggagctgcgtgctgctgttccttcccagcatcggaaggggccggga
ctccagggctgcctctcaggcactcaagccctgagctaagcatatccccttcctttaaca
cttgtggtggtgcttccgtttctctagaagtcaagggcaaggcctgcctttctgcctcct

 3.05 Intr + 130895 131000  106  1  1   79   63    43 0.699   0.69
aaggcctgcctttctgcctcctggatccctgctaaggcgcctgtacctgttgggcagctg
ctgatcagagtggctgagcaacttgctcaagatcacagtttcagaagtgggctctaagct
gggtctcgctgactccaaagttgtggcttttgttggttttcttgttctgtcgcgttttag
AAAGGGCTAGGAACCGAGCACTGGGCGTTGGGCTTACTCTCCTCCTATGGTGACCTGGGT
GACGTGCCCAAGGCGCTCTCTTCCCAGCACCTCAGGGTCCTCACTG
gtaaaggagggagtgattggaatgtcgccaaagttacttggctctggaattctgtggcta
ttcacgtggactctggatggcggtcaccaagtagaagaggggccctgggatagagagaag
tctcctctcctgctcctgatttcccaggcctctccctctcctggccctccctcctttctt

 3.06 Intr + 132024 132143  120  1  0   52   55    91 0.519   2.67
ctttggtgaggggaactggaagggccttctagatcacacatccaactccctcaattataa
atgagggcactgtggaccagaggagccaagggctttctccagggtcacacagtggaccaa
tgtcagggaccaggagggtccagatccctcagttcccaagccctacatcctcacgtccag
CATGCACGTGCAAGGCCAGCATGCCCAGCCTGGAACTGGAGACGCCGATCAGAGGGCCTG
GCAGGCTGCTGCCGGTGCCCATCTCACAGGCCCCGAGGGCTGATAAGGATGCCCTTGAAG

gtgattgatggtttgcaaagcacccacttattagtatttccactggacctctgaaaacag
tgatggagatagagagattgcatgtaacttgggacttgggaggtggcctgaaatgactgt
gacccagctgatttctctgaggacttaggaggaaatatctgaagttggactcttcttgac

 3.07 Intr + 133445 133515   71  0  2   91   83    17 0.259   0.40
ttctcggactgtattattttctgaaagtaagaaactttccctgggcagaactctttctag
ttcccatggggatgggcaggataggtgagaggccgagcccccacttccaggtctctgggc
agggcggggttaggcagcagcgggtgtcactcacacagtgactttcacttgtgctttcag
TGCTCAGGACATGGGCACCTGCCGGCTTCCTTCTAGCCCGGTTGGACAGCTCCGGCAGCT
GGTTTGGGGAG
gtaaaattataggagcgtgatgtcacccgggccactcagggcagagcctggctgctgggc
agaagggcacttgggccgggctgcttcagccgagagggccattcggtgtcctgcccacag
agagagaaacagtgagagaccaagagagcaaaccagagagatagggagggggaatgcaag

 3.08 Intr + 133821 134018  198  2  0    6   86   323 0.442  23.45
gaaacagtgagagaccaagagagcaaaccagagagatagggagggggaatgcaaggggtc
cctgggggactcaggagtcccagtggagaatgagaggcaggccccccgtggtggccgggg
ccctggctgccagaggaccgggctggtgaggaggcgaggatgtggactttcgtcacccag
CTGTTGGTCACGCTGGTGCTGCTGAGCTTCTTCCTGGTCAGCTGTCAGAACGTGATGCAC
ATTGTCAGGGGGTCCCTGTGCTTTGTGCTAAAGCACATCCACCAGGAGCTGGACAAGGAG
CTGGGGGAGAGCGAGGGCCTCAGTGACGACGAGGAGACCATCTCCACCAGGGTGGTCCGG
CGGCGGGTCTTCCTGAAG
gtaaccgcctggcaggaggccggcagggctggtggtgtgggcgccggaggccggggctga
ggggacgctgctgtggggagctccggacccagagttgggagacgccggaggaaaaggacc
aggaggcccccagggatcatgttccaccctgggagccagagtgtgtgtgcgcccaccaga

 3.09 Intr + 135081 135164   84  2  0   78   98   129 0.999  12.92
gccgcccacgccctgggagccctggcatggctcctgctacatgctgagccgggtttcctg
ctgggggagttattgggccatggctattgtggctactgctgtttcatttcctcgtcctcc
acccttcctcccagactcccactcaccaatcttgcattttctccctttctctaattccag
GGGAATGAGTTTCAGAATATTCCAGGGGAGCAGGTGACAGAGGAGCAATTCACGGATGAG
CAGGGCAACATTGTCACCAAGAAG
gtgggtgcagagtgttcccctctgtgctggggagaggcaggtgggctagaagctaaaagg
tggtagaagccagtggcttctccctgctgccctcacagcaggtgagcacagccaggctgg
ctgcccccgtgctcaggagggatggagggcccaggagctgggagctttggtcatctgcag

 3.10 Intr + 136882 136978   97  0  1  136   55   192 0.214  20.28
ccacaccgggctaatttttgtatttttagtagagacagggtttcaccatgttggccaggc
tggtctcaaactcctgacctcagatgatctgcacgtcagcctcccaaagtgctgagatta
cagacatgagcccccgagcccggcctgaccagccctttcctccttcccttcctttcctag
ATCATTCGCAAGGTGGTTCGACAGATAGACTTGTCCAGCGCCGATGCCGCCCAGGAGCAC
GAGGAGGTGACTGTAGAGGGGCCCCTGGAGGATCCCA
gtgagctggaggtcgatattgattactttatgaaacactccaaggtactgaggcgcccgc
ggccctgggggacccagcgccatcactgctgccttgctctgccgggccgtctgcatgaca
cctccctccactcacctctttatgagctctctctccagtctctcttctccctggtgggca

 3.11 Intr + 137259 137393  135  1  0  127   82    25 0.240   6.34
gccgggccgtctgcatgacacctccctccactcacctctttatgagctctctctccagtc
tctcttctccctggtgggcagtgtgtctgccacctccgtgtggcctcctttcgatcttct
gcctgtgttctgcccgtctttgcgatctgtcctgctttctgtctctgctgctgtctgcag
GTGGAGCTGAGAGGGAGTGGCCTACAGCCGGACCTGATAGAGGGCAGGAAGGGGGCGCAG
ATAGTGAAGCGGGCCAGCCTGAAAAGGGGGAAACAGTGACCCCGAGCCGCTCTCCTTGGA
GTAGCCTCTCGGGAG
gtaacgctgcccttctcatcccctctgcatggcctggtcttcagtggagtggctgctccc
tgtctcaccctatcccctcccagccaccccagcatgatgtgggacaaacaacttgttgtt
gtgtctcgaggcagagattctcacttcccaaccctgctaacagttggctctgaaccccag

 3.12 Intr + 143069 143190  122  0  2  129   56    69 0.829   8.01
gcatctcaggaagtcgggctgcaagtgcagcaccctcagcacatcgccctgcctggggag
actgcttttcctgagtcagattcggcctgagctgccagcacaaaactctgtgtgtggggt
ttttgctggacgttgcacttttgcattctaagtgactccttctctctttgtgtctcccag
GATCACACCTCGACACCCAACCCCTGAACCCCACACACTCTGCCATGCACACAGGAGGAG
AGCTGGACCTGAGGGCCACCGCAGCGGTGCACACATTCCTCTGGGCTGACGGCATGACCT
CT
gtaagggactcctgctagtcccctcttggcatgaatgactgactgtagacgcatgacctc
caggcttcaatcctgcctcttgcaatgacagctgatctgtcggaaccaggacacaaaagc
agcaagaagcggggagagagagggatagaaaacaagcgcaggagagcctgcgaacgcaaa

 3.13 Intr + 143254 143371  118  0  1   53    2    62 0.303  -5.86
cacctcgacacccaacccctgaaccccacacactctgccatgcacacaggaggagagctg
gacctgagggccaccgcagcggtgcacacattcctctgggctgacggcatgacctctgta
agggactcctgctagtcccctcttggcatgaatgactgactgtagacgcatgacctccag
GCTTCAATCCTGCCTCTTGCAATGACAGCTGATCTGTCGGAACCAGGACACAAAAGCAGC
AAGAAGCGGGGAGAGAGAGGGATAGAAAACAAGCGCAGGAGAGCCTGCGAACGCAAAA
gtgaatgagggctttttgtggctggggatgggttttggttttggggttttttttttaaat
tgttttgacttcgtacagggtactttttcccaacctcatctgtcagaaatccatgtgggc
ttcctggaaagaaaaaaaaaaaaaagaaaactaggcatgaaatcagtttaacaccttaat

 3.14 Intr + 144404 144457   54  0  0   79   97    56 0.319   4.55
aaggaaaggagtagggctagtgaatgtatctgccaggtcttagaagtcaggaccacccag
ggtctcccagagtgaacttggtgctctaagtccaggcagcctgcaggctggggaccctgg
gtgcaggtgccaggctcgaggctgttccctgtcctgcctcagtgcctcccctctgcccag
CCCCTGTGGCCTCTTGGAGAGGCGAGCCAGGGGGCTCCCCGGACCGCATGGCCG
gtgagagtagagtcggaggcggagagcctggacgcccagaggccggggccaggctctggg
tcaaggcaggaaggagacagacagctggcagttcctcgcctcggtgccatcagggaggag
ccttaagttccactagagcctccggcccagggaggccagaatcagcacaatcccggcccc

 3.15 Term + 145230 145357  128  1  2  124   50    46 0.412   2.84
gccagaggccaccccggcccggcctccagggcgcagaggcgcccccctccatcctccccc
atcccgggggccacggcaggggggccgcacagcgcggctgggaccgattcggtgacggcc
caaggaagctgggctcagggctcgcctctcccgcctcgatcctgcaccttcctctcccag
GTCGCTGCTGCAGCCAACCCAGTAGCCCCCTTAGCGCCCCCGCGGACCCCGCAGCTCCAG
ACTCCGCTTTGGCACCTCTGCTCCGGCTGGCATGGCTGCACGCTCCGGCTGCTAGTAGGA
GCCGTTAG
gggaggagtttggggtctccacacgatgcctagagaatgctgcagtctgcacattagacg
ctttttagaagttttgaaattaccttgatttttttaattgttatgaaaatggatcttttc
ttgactctcccacatgctctgttatgggagagaatcccctaccctactctgatgtataga

Predicted peptide sequence(s):


>ANK1_1|GENSCAN_predicted_peptide_1|209_aa
MVFSPGGLYEEVTLGELDAGRDKAAAPGHAQAVTVSLKRGKLWTTHKPNSQDSLLSSHSP
TGRATMPGNSERRLLGRIHENLFSPQHSCARCLLRGNTSPVQCHPHQSKGCSGQVNVDNA
NLVLTESQTKEAYYSPEQGQQPQGNHDGLWFPGADWRCGEGTYLMEDKVQKAAEHSLEGP
MLLSGRFAGNLGTILITPGPKITTFLGTE

>ANK1_1|GENSCAN_predicted_peptide_2|1801_aa
MEQMEGGSGGEPNGSAGHSQQQDTARAAADRERGGTTESTHCFFAAENMGIEKGALETCK
ETVARCRVTCWRSPRRPADNREGEREPGSDFSAGAGRWQRDRAGPGQTLRGEDVKRCFVE
EDESSIWSSAVDLESSVFKGVQGWSSLADAATSFLRAARSGNLDKALDHLRNGVDINTCN
QGPSASAVDLLLRCRISQSTGLLRVLYNQNRKKTPDTLLPMPCRAPPCSLPSKADISSWN
GLNGLHLASKEGHVKMVVELLHKEIILETTTKGCGNTRLQRFDCFRISSPGCDFASEHLK
GNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQ
NVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDP
NPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRL
LLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDH
LDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHI
ACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV
ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPN
LATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLE
RDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEV
ARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQ
EGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSP
LHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVL
VSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESP
AIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTGFLVSF
MVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLSTPPPLAEEEGLASRIIA
LGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHRSRYGESYLDQILNGMD
EELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLKSKLVPLVQATFPE
NAVTKRVKLALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTD
NPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLVYANECANFTTNVSARFWLSDCP
RTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYCMTDDKVDKTLEQHENFV
EVARSRDIEVLEGMSLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAMPVKVRDSSREPG
GSLSFLRKAMKYEDTQHILCHLNITMPPCAKGSGAEDRRRTPTPLALRYSILSESTPGSL
SGTEQAEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENPNSLLEQSVALLNLWVIR
EGQNANMENLYTALQSIDRGEIVNMLEGSGRQSRNLKPDRRHTDRDYSLSPSQMNARSAS
HWWEVWFVSNKFLLSGEAEAKEREMAAPVQVGIASALAFAALQNGPQALAISNCVPTGRG
V

>ANK1_1|GENSCAN_predicted_peptide_3|806_aa
MGELELSYTTGGNAKWYNHLIISDKVKHIPTVQSSHSIPSYLPKRKESIMSIQTSIFTCN
SHKLEAAQMSIGSLARAKRGFPQSLPLCSPSPNHPTFTGSSSPLIWDLEPSYSSLQDELL
SPASLGCALSSPLRADQYWNEVAVLDAIPLAATEHDTMLEMSDMQVWSAGLTPSLVTAED
SSLECSKAEDSDATGHEWKLEGALSEEPRGPELGSLELVEDDTVDSDATNGLIDLLEQEE
GQRSEEKLPGSKRQDDATGAGQDSENEVSLVSGHQRGQARITHSPTVSQVTERSQDRLQD
WDADGSIVSYLQDAAQGSWQEEVTQGPHSFQGTSTMTEGLEPGGSQEYEKVLVSVSEHTW
TEQPEAESSQADRDRRQQGQEEQVQEAKNTFTQVVQKGLGTEHWALGLLSSYGDLGDVPK
ALSSQHLRVLTACTCKASMPSLELETPIRGPGRLLPVPISQAPRADKDALEVLRTWAPAG
FLLARLDSSGSWFGELLVTLVLLSFFLVSCQNVMHIVRGSLCFVLKHIHQELDKELGESE
GLSDDEETISTRVVRRRVFLKGNEFQNIPGEQVTEEQFTDEQGNIVTKKIIRKVVRQIDL
SSADAAQEHEEVTVEGPLEDPSGAEREWPTAGPDRGQEGGADSEAGQPEKGETVTPSRSP
WSSLSGGSHLDTQPLNPTHSAMHTGGELDLRATAAVHTFLWADGMTSASILPLAMTADLS
EPGHKSSKKRGERGIENKRRRACERKTPVASWRGEPGGSPDRMAGRCCSQPSSPLSAPAD
PAAPDSALAPLLRLAWLHAPAASRSR