GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:11:47

Sequence ZNHIT1_1 : 8422 bp : 54.98% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init -    309    201  109  0  1  106   94   228 0.986  23.54
 1.00 Prom -   2322   2283   40                              -1.31

 2.01 Init +   3569   3647   79  1  1   57   92     1 0.516  -1.42
tcaaacaatccacccaccttggcctcccaaagtgctgagataacaggcatgagccactgc
gcctggcaaggtcatgctttttgatgctgggtagttctttgactcctgacctggccactt
gttagctatgtgaactttggacacatttcttaatctctgaatgttggtaaattggggatg
ATGATACTGTCCCATACAGCTGTTGTAAGGGTTAAATGGTTCAAGTGTTGCAAAGAGCTG
AGCACGTGCCTGGCTCATA
gtaagtgtccaacaagtgatagctactggggctgctgctgttattattatgcttaacagg
tggttaatgaataaagagatatattatgcaaaattatcagaatctggcaaacagctgata
aggcaatgaggaaagaggttttttgttttttgtttttgagacagggtctctctctgttgc

 2.02 Intr +   5639   5809  171  0  0   75   81   295 0.929  27.93
aggaagtgtgggcccagggcttggcccgggaggagacaaggggaccaagggcttggcaat
ggggatgagatcagagagctgcagcttccaccccgggtgccttcctcgccctgcccagag
cggcggccacactgctctttcttggaagccctgtaactttgcgtgccctgctccatccag
TTCGCTCCCAGGACCCCGGGCAGCGGCGGGTGCTGGACCGGGCTGCCCGGCAGCGTCGCA
TCAACCGGCAGCTGGAGGCCCTGGAGAATGACAACTTCCAGGATGACCCCCACGCGGGAC
TCCCTCAGCTCGGCAAGAGACTGCCTCAGTTTGATGACGATGCGGACACTG
gtgaggcggatggaggaggaagcgggggatgggactgagaggagggcgggagagtccgcc
caactcaggctgtgggaggacccaggagctcctggtgcctctgccagtgactggctccca
tggctgtgagcaaccacaccccctttctgtgcctcagtttcctctcgtgtatgtgaaata

 2.03 Intr +   6512   6591   80  0  2   46   94    75 0.999   3.67
aacccaggagatggaggttgcagtgagtcaagatcgcaccactgcactccagcctgggtg
acagagtgagactgtctcaaaaagaaccaggagggcacatgggcatggggagtgatgaac
cagagaaagctgctgtctttctgggcaagtgccaagcaacggatcacccttgacccctag
GAAAGAAAAAGAAGAAAACCCGAGGTGATCATTTTAAACTTCGCTTCCGAAAAAACTTTC
AGGCCCTGTTGGAGGAGCAG
gtgagaggagggtcggcctgggaggaccccacagggaaggggtgagcctggcccgggcag
gtgttcgctgcgtgggtgggcggaggagttctagagccggccccttgtctctgcagaact
tgagtgtggccgagggccctaactacctgacggcctgtgcgggacccccatcgcggcccc

 2.04 Intr +   6708   6877  170  2  2   73   99   147 0.995  13.56
aacccgaggtgatcattttaaacttcgcttccgaaaaaactttcaggccctgttggagga
gcaggtgagaggagggtcggcctgggaggaccccacagggaaggggtgagcctggcccgg
gcaggtgttcgctgcgtgggtgggcggaggagttctagagccggccccttgtctctgcag
AACTTGAGTGTGGCCGAGGGCCCTAACTACCTGACGGCCTGTGCGGGACCCCCATCGCGG
CCCCAGCGCCCCTTCTGTGCTGTCTGTGGCTTCCCATCCCCCTACACCTGTGTCAGCTGC
GGTGCCCGGTACTGCACTGTGCGCTGTCTGGGGACCCACCAGGAGACCAG
gtgagcatgagacctgctgtccactcccactccctccttcccacagcctccccagacctc
tctcccctcatcctggcttcccctctgtctgcaggtgtctgaagtggactgtgtgagcct
gggcattcccagagaggaagggccgctgtgcactgcccggccttcagaaagacagaattt

 2.05 Term +   6972   6993   22  0  1  143   52    17 0.984   1.67
tgtggcttcccatccccctacacctgtgtcagctgcggtgcccggtactgcactgtgcgc
tgtctggggacccaccaggagaccaggtgagcatgagacctgctgtccactcccactccc
tccttcccacagcctccccagacctctctcccctcatcctggcttcccctctgtctgcag
GTGTCTGAAGTGGACTGTGTGA
gcctgggcattcccagagaggaagggccgctgtgcactgcccggccttcagaaagacaga
atttcatcacccaatgcagggggagctcttcctggaccaagggaggagccgctcattcac
ccaacaaaactgtgtcttatctgccaggaaagaccagcctcactcctgggaactgtctgg

Predicted peptide sequence(s):


>ZNHIT1_1|GENSCAN_predicted_peptide_1|37_aa
MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPX

>ZNHIT1_1|GENSCAN_predicted_peptide_2|173_aa
MILSHTAVVRVKWFKCCKELSTCLAHIRSQDPGQRRVLDRAARQRRINRQLEALENDNFQ
DDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNY
LTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV