GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:27:38

Sequence WNT2_1 : 48463 bp : 42.77% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    579   1043  465  0  0  104   -2   249 0.615   8.81
cgcgggcccaagcccctctctcttggctgggcgggggcccaggtccaggaccgagggtcc
cttaacctccacaaggcgcacaggctgagcgcccaggcggcaggaggtgcaagggcgcac
acccccggcgaacgcctggctgcctcggttcctctctatgtgatcttttgcgctccgcag
CTCCGGAGAGGAGCTGGGTGTGCGTAAAAACTGCATCTTTCCTGGGTGCTTTGGCAGATA
CTGCTGGGTTAGGTCCCGAGGGTCATGGACCCTCCAAGTTCCCCTCCCTATGGGCTCTGT
ATTTAAGCCCAGCACCAAGGAATCAAAGCCAACAGGTCATTTCGCAGAGGCCTGGCCCCT
CCCTAACCTTGCCCTGCATAGACGCGGCAGCTCCAAATTTACAAGTGCTAGCTCTTCATC
CCAGCTTCAGGGAGAGAAGCGAAGCAATGAGTTGAGAATCATCTCTGGATTCTTGTATCC
CATGCATAGTAATCTCCTTATCCCCTGGCCCCCTTCCTCGTTTCCTCACATTGCACGCTC
AGGGACTTGTTTGCCAGCGGATGGCCTCGGCAATCCGGAACGCACGCTCCGAGAGCCCAC
GGATGCTCTTTGGCCTGGAGCTTCCCTAAAGGTTCCTGTATTCGC
gtgtgctcgtaaccatgcagcgatgttcccccttccccgcctcacctcatccccagacat
ctcttgccatcatttcatgcacccgtgtctaaaaccccgcgtttctccccacccccgcca
ggcgcagcaccccctccctcggctgcgcccggaggggagcagagcggacggggcgcgcgg

 1.02 Intr +   1567   1734  168  1  0   48   89   136 0.904   7.84
cggcgaggcgccggcggccgtgacgaggcgctcccggagctgagcgcttctgctctgggc
acgcatggcgcccgcacacggagtctgacctgatgcagacgcaagggggttaatatgaac
gcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacccccgag
GTCAACTCTTCATGGTGGTAAGTCCACGCGCACGGGCGCGGGGGATTTTGGAGATCGGAA
TGGGGACCGCATTGGCCACATAGACCCTTCCTGGCTGCGTTCCCCCGCGGCCGCAGCAGT
CTCGGATTCTGGCCCGAACCCTGGCTACTGCCCTCTTATCGCCCCATG
gtgagccccttctcttttcccagaagatcatttcagctttgacaactccataaaaccaca
ttccccctcaaatgagagctccgatgtttggtttatttggatccagctgagcgacagcaa
aatcagccaatttcttatcctgttgagagacgtgctagcctggtctccagctctagcaca

 1.03 Intr +   3699   3925  227  0  2  118  100   201 0.658  21.01
gcctgccttgccggtttctccactaaattaaaaagtaaatacccttgctttctaatatca
ccagaaggataaggaattcatatttgaaaagtgctttgaactccttagtctcccaggaac
actgagccaggcctccctgttcacgttgccctcacctctgtgttggttggtcccttatag
GTACATGAGAGCTACAGGTGGCTCCTCCAGGGTGATGTGCGATAATGTGCCAGGCCTGGT
GAGCAGCCAGCGGCAGCTGTGTCACCGACATCCAGATGTGATGCGTGCCATTAGCCAGGG
CGTGGCCGAGTGGACAGCAGAATGCCAGCACCAGTTCCGCCAGCACCGCTGGAATTGCAA
CACCCTGGACAGGGATCACAGCCTTTTTGGCAGGGTCCTACTCCGAA
gtaagtctcctgccttcacccagccctatggctctccactcatgcacagctccctcactc
catcttcaaagaccctgcttatcttctattgcattttattccatcagaagtttgttcagt
tgggcgtcattgtccctgttctacaggtgaggactagagaaatcaaggaacatgtctaga

 1.04 Intr +   9143   9420  278  0  2   53   86   289 0.379  21.51
gatggttcatattaaagaaagagcctgggctctagaaaagaacccttcaagaatatcagt
accttgttgtctagtggcaaaggttgtctgaaacagagcaaatattaaacaattgtcata
tgaaagttattcagaaatagtgctaccggaccacttttaagaaaagcatttttgtttcag
GTAGTCGGGAATCTGCCTTTGTTTATGCCATCTCCTCAGCTGGAGTTGTATTTGCCATCA
CCAGGGCCTGTAGCCAAGGAGAAGTAAAATCCTGTTCCTGTGATCCAAAGAAGATGGGAA
GCGCCAAGGACAGCAAAGGCATTTTTGATTGGGGTGGCTGCAGTGATAACATTGACTATG
GGATCAAATTTGCCCGCGCATTTGTGGATGCAAAGGAAAGGAAAGGAAAGGATGCCAGAG
CCCTGATGAATCTTCACAACAACAGAGCTGGCAGGAAG
gtatggaaatgcaacggtgctcattttgtaggctgcatggctttataaaccacttaggca
gagcttatcttaaacttccctagaattgataaaatgctgtgtagtcacaacttcctactg
tcccccagccattagctgtttgttcggaagaataccaacaactaggttgaaatattccca

 1.05 Intr +  26613  26877  265  2  1  109  111   266 0.720  27.16
agtcagggcaggtggctaatgtggctaacaagtgacaagcaatgcttcaacatttcccag
tcacttgccccaggatccagcatcctgagaatcacttctggattgctgggaggtaaggag
agttggagcatgtgtcacctgctcgaacctcactgaacttgcccctgtctttttcggcag
GCTGTAAAGCGGTTCTTGAAACAAGAGTGCAAGTGCCACGGGGTGAGCGGCTCATGTACT
CTCAGGACATGCTGGCTGGCCATGGCCGACTTCAGGAAAACGGGCGATTATCTCTGGAGG
AAGTACAATGGGGCCATCCAGGTGGTCATGAACCAGGATGGCACAGGTTTCACTGTGGCT
AACGAGAGGTTTAAGAAGCCAACGAAAAATGACCTCGTGTATTTTGAGAATTCTCCAGAC
TACTGTATCAGGGACCGAGAGGCAG
gtaagttcaaaagactttctttatagtacctaattctttcaacaattgatactccacaat
ttaaatgaggttctgtattttcagcctgctctctttaggttcaaagctcacgatccttat
cattcttattgaaactgtacagggctgggcgcggtggctcatgcctgtaatcccagcact

 1.06 Term +  39333  39631  299  1  2   84   33   219 0.992  10.44
cataatttggagacatgcatcctggcattacaaacaaattattctcatttctcttaaagg
ttacaggcatccagtaggaatatcagtataggaaaaatgcagcatgagcaactgacacca
tgttaacccagtctttttttcagtttcttacataactttatgtgttgtaattgtctacag
CATATCATGAGCTGAAGAAAAAGGCCCTCTCCCCAAAAAGTTACATGTCAGGATCTTTGC
ACGTTACTCATTTGATAAAAGAATTAGAAGAGAGTACGGGAAAGACGCTGCTGCACTGGT
CACATAATGTTATAAAGCAGGCTGCTTTCTGGTGCCTGGCCGGGCACCAGGACTGGGCAC
TCGGCAAAGGGTCAGAATGTCACGACTGTCAAGAGCTTGAGCTCTACAGTCAGGCAAGCC
TGCTTGCAAATCTTGTCCTTGCCACCAGCTGCCTGTGTGATCTTGGGCAAGTTACTTAA
tcttcctgaatctccatttcctcatttccaaaatggtgataataatagtaccttccttat
aagcttatgagaattaaattagacaatgcaggcaaaatgcttagcatggggcctagctca
cataagtgctccataaatattggctccagttgtgaacagaaagaaaagaaagagagtgaa

 2.07 PlyA -  40158  40153    6                               1.05
 2.06 Term -  40880  40782   99  2  0  123   47    83 0.911   4.85
 2.05 Intr -  42164  41964  201  2  0  -11   -7   244 0.182   3.56
 2.04 Intr -  43938  43734  205  2  1   47   77    89 0.017   1.98
 2.03 Intr -  44535  44332  204  2  0  109   20    82 0.009   0.89
 2.02 Intr -  46280  46075  206  2  2   33   47   153 0.108   2.78
 2.01 Intr -  47117  46890  228  2  0   97   91    27 0.091   1.04

Predicted peptide sequence(s):


>WNT2_1|GENSCAN_predicted_peptide_1|567_aa
XSGEELGVRKNCIFPGCFGRYCWVRSRGSWTLQVPLPMGSVFKPSTKESKPTGHFAEAWP
LPNLALHRRGSSKFTSASSSSQLQGEKRSNELRIISGFLYPMHSNLLIPWPPSSFPHIAR
SGTCLPADGLGNPERTLREPTDALWPGASLKVPVFASTLHGGKSTRTGAGDFGDRNGDRI
GHIDPSWLRSPAAAAVSDSGPNPGYCPLIAPWYMRATGGSSRVMCDNVPGLVSSQRQLCH
RHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISS
AGVVFAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKE
RKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWR
KYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAAYHELKKKALSP
KSYMSGSLHVTHLIKELEESTGKTLLHWSHNVIKQAAFWCLAGHQDWALGKGSECHDCQE
LELYSQASLLANLVLATSCLCDLGQVT

>WNT2_1|GENSCAN_predicted_peptide_2|380_aa
ILSEKELSFPKDFLYQGDSNAKQSLSEAFALTKIQHTIVPKDTRPHLVTSDFNMAINALK
NTHFKLKRVLKAILLQSFQAVLTAHGAAPVELTPTLGHPGDMGGVVASPTAHDFTAVHAP
GSQVAHTACCTQGAWKTSQGVLLKSPLCVGIIYRNVMLPCLFGMTREAARFKQGTGSRRG
EGGAAFGQNDWRRRAGRLAGELHEDRKDGKRPGTVMCKAPQQTELKDSQMRLFRAWTISV
QIPDLPCINRVALGKLLKLVKLQFPPVQNWNKNSSFIIELLKKVVEEEEKGREEKEGEEE
EGKEEEEEEDKEEEEEKRKRRKRRRGRRRGRRRKKKKEEEEEEKEKAMMQKTEPDCLNRR
IAQCSDLNTIRTQREEQTKL