GENSCAN 1.0	Date run: 16-Jan-104	Time: 20:51:29

Sequence TRA2A_1 : 29339 bp : 41.74% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    884    972   89  1  2   47  105    48 0.380   0.25
cgggcgtggtggcgcgcgcgggagcctgaggtgggaggatcgtctgagcccgggagtttg
aggctgtggtgagcagtgatcgcttcactgcacttcagcttgggtgacagagcgagaccc
tgactcaaaaaataaacaaacataaaaaaacgcttccaatgttttgttcccttacatcag
AATCCACTTGGACAATATTTAAAGGGGCTAAGGTCATATAAGGCTCATCTGGCGACTGAA
AAGTCTTCAAAGAGGTTGACGCGTCCGAG
gtgagtctgaagtttggaggacagcacgggaccgcgattccaaggcgcccaggttgagag
cgcagaccgcccgccaacctccaccctcgctccaggcccagccgacacaaagcctcgcgg
gaggtggagcctcgtgacgtcacagagacgcccgccccctttacgtcgtgctctgaggag

 1.02 Intr +   1317   1443  127  0  1   44    0   192 0.193   5.76
gtcgtgctctgaggaggccaggagatttctggcggcgccggcgccattttgctggagcct
gcgaccgagtgggagtggagtggagcggctgtggttgccgactctttcctcttccccacg
gtccagtcagcgggttaattaggccatcggccctcgagccgagacttgtctcttatttag
TTCTGGGGAGCGCCTCGTCGACATGAGTGATGTGGAGGAAAACAACTTCGAGGGCAGAGT
GAGTACAAAGCCGCGGGAGCCGTCTAGGCGGCGGCCCAATGCTCGGGGTTTCACGGGAAC
AAGCGCG
gtcgggcggggttgcgggtagtcccgcgaggagcaacctctggagccatcgcgattgatt
cctcccatcccaagatggcttctgggttccactccttccccaaacaccacggataacacc
cctcccccttttttggaggctgactgatacctggacttctgggtcctcttccctccccgc

 1.03 Intr +  11325  11458  134  2  2   58  111   104 0.251   8.22
attgaggacagttagcagtattaacagtgggttattattgagctgaaattttttctggag
ggtgttgtctaaccatttgtttttcaggagcaatcaatataaataattacggtactttaa
atgttaggtgttaggcatctacatgaccagtgccatttgtaatactgtcttctttgttag
GAGTCTCGCTCTCAGTCAAAATCTCCAACGGGAACTCCTGCTCGTGTAAAATCGGAGAGC
AGGTCAGGATCTCGTAGTCCATCAAGGGTTTCCAAACACTCTGAATCCCATTCTCGATCA
AGATCAAAATCCAG
gtaagtgtgtttaagataatacttaaaatattcttctggggtttttgaggacaaagcagt
tgttggctgcattttgtgtagaaatttcacgaaagactcaaaattatagtttttctcaga
ctgctctttgtaaatgaatactatatcccagacaaagacttggaagtatggcttgagccc

 1.04 Intr +  16637  16802  166  2  1   58   83   109 0.196   6.44
ttgactgagaagagtggaagatgtagtgacttaagtgaaccaaaggaagaataccctttc
ctcagaagcaaggaggaaggacctgagaatagttagggatatatgtataccttcttggaa
gagggaaggactttagccattttgtttcagtatttttacctaaatgtatttctctcaaag
GTCGAGGTCAAGGAGACATTCTCATAGACGTTACACTCGATCCAGATCCCACTCTCACTC
TCATAGGAGACGATCTCGAAGTAGATCATATACACCAGAATACCGGCGGCGAAGGAGCCG
AAGCCATTCTCCAATGTCTAACCGGAGAAGACATACTGGCAGCAGG
gtacgtggtttataaaagttaatgaagacttattttctcttttatgtgtttagtcatggc
atatcttgcttttaggggagcttggccattgtttagaagtgatactctggaaacatcctt
aataagctgctttagctttcaaagtaaaggaaatgccaccatctttcgtaagcttaccat

 1.05 Intr +  20083  20271  189  0  0   37   84   176 0.479  10.96
ggtgtactgtgaattgtaaaatatggctcatctgctctagttctcttaaaatcttatctc
caaattattagaaacaatatatttattgtgtattagatgaggtgttctaaacaaagtatt
tctgtgtttctttgattttgattttaatttggagttttaaataatatttccattcaatag
GCAAATCCAGATCCCAACACTTGCCTTGGAGTGTTTGGCCTCAGTTTGTACACAACAGAG
AGGGATCTTCGTGAAGTATTTTCTCGATATGGACCATTGAGTGGTGTCAATGTGGTTTAT
GATCAGCGAACTGGGCGATCTCGAGGATTTGCTTTTGTGTATTTTGAGAGAATAGATGAC
TCAAAGGAG
gtaaatttgtcttttatatgcctgattatagtactgaattagtgtgaaaagttgattaat
agacttatttctgtaaacattgcatccttttttcttcctttttttctttttttttttttt
aaagataggatcttgcgtccaggcgcggtggctcatgtctgtaatcccagcactttggga

 1.06 Intr +  25608  25723  116  2  2  107   52    98 0.993   6.43
tgtgttctggacattgttgaggtctagaattgtctatacaatgccctgtacaagctacat
tgctgtcattttcaaaatcaggagtttatttggattacatatactttgtgcttaatttta
agtaatgattacttcaagactggtgaattatacgtgactttttgtgcctgttctttatag
GCTATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCT
ATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGACCAACTCA
gtaagagttcaagtttcctaagctaaactatgaaatccaccagaaatatgtgcaaaattt
tgattactcagaaacttttttcctataattagaattgattctggcaaggggcaacatggc
aaaaccctgcttctactaaaaaaaaataaaaaatcagccaggtgtggtggcacatgcctg

 1.07 Intr +  26878  27006  129  1  0   18   95   169 0.816   9.49
atgtagggaataaggcaaaccagaataccatgggagtcagtaaaatgagatacggaggca
atttctcatgaaagggatgttcttcctcacttttctcttttttaagccattcaatttgta
ttaaagtgtcctggaaaatagtcattcacactaatggagaatttttacatttttctgcag
TAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCG
AGATTCTTACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTA
CCGATACAG
gtaatgttttaacttgagctttctgttctaaattagatgatagtagtgttacttggcact
tttatgttggatacatatgaataaaaacttgatttttaaaatagatcatatatgacgcct
ttgggagcagaagttagcagtctgtatatgtcagtattttgttgtgctatatacttttct

 1.08 Term +  27331  27406   76  1  1   59   43   100 0.674  -1.07
tatatgtcagtattttgttgtgctatatacttttctggtctcattggcagaaagagaact
taatattaagtagttatcaccttaggtacattattattttgaatgatgaggaatttttat
tttcatctgcctcagtggagtgattatatagtatgctaagtaatctttcatttcttacag
AAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAAGATCTCGTTCCTA
CAGCCCAAGTATGTGA
actttacttttgtagcataaaaaacctcatttctaattaatggcttactttagaatatta
gagtataaggtggaaggtggcagttaatagttggaaaaatatgaggcaaattaaactata
attgttaactttttttttttttttttttttttgctttttctcttttaggacgctattgat

Predicted peptide sequence(s):


>TRA2A_1|GENSCAN_predicted_peptide_1|341_aa
NPLGQYLKGLRSYKAHLATEKSSKRLTRPSSGERLVDMSDVEENNFEGRVSTKPREPSRR
RPNARGFTGTSAESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPSM