GENSCAN 1.0	Date run: 16-Jan-104	Time: 20:49:15

Sequence TOMM7_1 : 12298 bp : 41.79% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.05 PlyA -    147    142    6                               1.05
 1.04 Term -   1302   1180  123  0  0   53   53   154 0.016   5.80
 1.03 Intr -   1424   1393   32  0  2   80   99    11 0.007  -1.67
 1.02 Intr -   1973   1870  104  1  2   72  110    55 0.008   5.00
 1.01 Intr -   4135   4013  123  0  0   63   64   113 0.017   5.18

Predicted peptide sequence(s):


>TOMM7_1|GENSCAN_predicted_peptide_1|127_aa
XTILPEALKVMIEPKLHTKLNPQLLVLVRVEVEEVKEQPGASQHSCATLAKKFLYGCFLT
CKMGAVIEIIQTLHRTVTFPVLLPLTQLHHGDGRVAQGGPLTATTASGIRKGKEVRRRHT
RPLRQES