GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:25:13

Sequence TES_1 : 50651 bp : 37.89% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 Intr -   1387   1088  300  1  0  115  100   322 0.633  32.11
 1.02 Intr -  21032  20911  122  0  2   59  108    37 0.356   2.09
 1.01 Init -  29722  29686   37  1  1   59  113    20 0.273   1.84
 1.00 Prom -  31247  31208   40                              -4.55

 2.01 Init +  35128  35177   50  0  2   66   98    22 0.446   1.48
ttctgcctgtgagccagtaaaattaaaagcaagttagttacttcctagatacaatgaggg
tacaggcattgggtaaatacagccattccaaatgggagaaattggccaaaagaaaggggc
tacaggccctatgggagatcaaaatccaatagggcagtcattaaacgttaaaattccaaa
ATGTCCTTTGACTTCATGTCTCACATCCAGGGTGTGCTAATGCAAAAAAG
gtgggttcccatggccttgggcaactccgcccctgtggctttgcaaggtacagtcccact
cccagctgctttcattggctggcattgagtgcctgcagctgtccttggatctcccattct
ggggtctggaggatggtggccctcttctcacagctccactaggcagtgcccttgtgggga

 2.02 Intr +  39691  39943  253  1  1   55   27   292 0.998  16.31
cgtgttttgtttccttcttgcttaaatatatggatacttattctccctcctaaaaaagga
cttgcctttgcataccatgatatagaataggcctaaaagtattttatgaactataaatgt
atgaacataaatatcaattaggtacaattaatcattttctacttattttcaaaattatag
AAAAATATGTCGTAACTGCAAGTGTGGCCAAGAAGAGCATGATGTCCTCTTGAGCAATGA
AGAGGATCGAAAAGTGGGAAAACTTTTTGAAGACACCAAGTATACCACTCTGATTGCAAA
ACTAAAGTCAGATGGAATTCCCATGTATAAACGCAATGTTATGATATTGACGAATCCAGT
TGCTGCCAAGAAGAATGTCTCCATCAATACAGTTACCTATGAGTGGGCTCCTCCTGTCCA
GAATCAAGCATTG
gtaaatgatatggaacagagagtttctttattgaagttcctggagtatttatttggggca
gtttctttgatgacctaatcaacttcacacatcccagatctgttattcttccggggttct
cattactttgacttctgattcctgttctagtcttttgaatgtaagactagatacttcata

 2.03 Intr +  40832  41167  336  1  0   79   92   441 0.999  38.39
aactaaatctatttagtgtaccgtttttgagttttaacttcttaatatactgtgagggtg
agttgctgctattggatagaacccacttctttcttaagtaacttgcttctgatgtgtgtt
atgaaacatcacactgcctaatggccaatcccagttaacattggcctccttgtggttcag
GCCAGGCAGTACATGCAGATGCTACCCAAGGAAAAGCAGCCAGTAGCAGGCTCAGAGGGG
GCACAGTACCGGAAGAAGCAGCTGGCAAAGCAGCTCCCTGCACATGACCAGGACCCTTCA
AAGTGCCATGAGTTGTCTCCCAGAGAGGTGAAGGAGATGGAGCAGTTTGTGAAGAAATAT
AAGAGCGAAGCTCTGGGAGTAGGAGATGTCAAACTTCCCTGTGAGATGGATGCCCAAGGC
CCCAAACAAATGAACATTCCTGGAGGGGATAGAAGCACCCCAGCAGCAGTGGGGGCCATG
GAGGACAAATCTGCTGAGCACAAAAGAACTCAATAT
gtaagtagagtggtcacactgttagcctgatttgtatactttacagaatttttttccctt
actttgaacttttttggggactattcctctgagtttccaaaagggaataagtatggggaa
taaataggatttagattcagtttagacttcccacagagggtcatcgtgtttgaaacttct

 2.04 Intr +  42431  42646  216  1  0   67   87   179 0.994  13.48
ggctgaggcaggagaacggcgtgaacccaggaggcggagcttgcaatgagccgagatagc
accactggactccagcctgggcgacagagtgagactcagtctcaaaaaaaaaaaaagaaa
gaaagaaaagaaatggcagtcttctaatgactaggttgttctggatggcttccctttcag
TCCTGCTATTGCTGCAAACTGAGTATGAAAGAAGGTGACCCAGCCATCTATGCCGAAAGG
GCTGGCTATGATAAACTGTGGCACCCAGCTTGTTTTGTCTGCAGCACCTGCCATGAACTC
CTGGTTGACATGATTTATTTTTGGAAGAATGAGAAGCTATACTGTGGCAGACATTACTGT
GACAGCGAGAAACCCCGATGTGCTGGCTGTGACGAG
gtatgttctatgggaccaccggcatgctggtgccctcttagaccctcatatggtcccttt
acctagaaggcaacaagacttgaccaaacagcagttgctctgtttacatccaaagaagtt
ttaaaaaataaacttctgatatcattcattctgtctgtgttaattgggttgacaaatgaa

 2.05 Intr +  42989  43147  159  1  0   81   69    86 0.937   5.26
attgggttgacaaatgaaagactagaaatataaaagattgatttagactaaactaagtga
tagcataagttcaagctttaggttatcattttcaaactttagaccctgagaaagtatgtt
gttacagatataaatctcttattatataaaaatccatctttatttttatcttcttcctag
CTGATATTCAGCAATGAGTATACCCAGGCAGAAAACCAGAATTGGCACCTGAAACACTTC
TGCTGCTTTGACTGTGATAGCATTCTAGCTGGGGAGATATACGTGATGGTCAATGACAAG
CCCGTGTGCAAGCCCTGCTATGTGAAGAATCACGCTGTG
gtgagaagtgttctaaggatatggttgcctcagcctgctttaggacttgagtttatgctt
ttcttaaagcctcttacaaatgggaaacagaaagcagtcctcctaagtagaaagcaaatt
attcctaccacagggtgttaaaatcaaggcaattcaaaaacaatacatgcattgactatg

 2.06 Term +  47965  48153  189  0  0  111   49    52 0.838   0.07
atattgacctccattaacagttggccaaaaaggttagctagaaggccaccctccattgtg
tatttctgaggttgtcattatgagttttaatttatcatctaaagaaatatgtcctaagat
gaaaatgttaccattacagcttgatctctcaccctcttctcttgtattatttcttaatag
GTGTGTCAAGGATGCCACAATGCCATCGACCCAGAAGTGCAGCGGGTGACCTATAACAAT
TTCAGCTGGCATGCATCCACAGAGTGCTTTCTGTGCTCTTGCTGCAGCAAATGCCTCATT
GGGCAGAAGTTCATGCCAGTAGAAGGGATGGTTTTCTGTTCAGTGGAATGTAAGAAGAGG
ATGTCTTAG
gaggagggcacccagaagtatcgagccatagctatccaaagtggtctgcatttctactgt
aaaatgcaatttgaaaaaaataaaacgcaaaaaaagaaactgtaaaggaaaccaagagat
tttgtttaatttttttggccattttttcttcatcaattttttttcggtctcaacttttaa

Predicted peptide sequence(s):


>TES_1|GENSCAN_predicted_peptide_1|153_aa
MSLKADSSLALKVRFVTAWKKCPSTFPNTNTFIFPTCSDLSVRELLNITDREQVHVNASY
GSPPPPIRDPTAGFSWPPAPLRTRETCGTPAAPLNSHSPGAVELPPPSPPQRACGPDPGT
KGAGQPMAAGQLRAAANHRAPHAPSRPERGAGK

>TES_1|GENSCAN_predicted_peptide_2|400_aa
MSFDFMSHIQGVLMQKRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKS
DGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSE
GAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQ
GPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLW
HPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNW
HLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFS
WHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS