GENSCAN 1.0	Date run: 16-Jan-104	Time: 21:11:57

Sequence STK17A_1 : 45399 bp : 39.76% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1318   1523  206  0  2   79   94   133 0.488   9.46
cgcggggcgcggggcgggcccgagctaccggtagtctgcctgccgcagtccgagcgccgc
gctggggagagcgggtgtttgaaggctccgcggaccggcactaggagccgggggcgggtc
cgtgaccctccggctgctcggagtgaacaggcggccaggaaagaagcgggcctgaacacc
ATGATCCCTTTGGAGAAGCCAGGCAGCGGCGGCTCCTCCCCAGGCGCCACCTCAGGCTCG
GGCCGGGCAGGCCGGGGTCTGAGCGGGCCGTGCCGGCCGCCGCCGCCGCCCCAGGCCCGC
GGGCTGCTGACAGAGATACGCGCCGTGGTGCGCACCGAGCCCTTCCAGGACGGCTACAGC
CTGTGCCCGGGCCGGGAGCTGGGCAG
gtgaggacgggcggggcccggcgcggaaccttcccggacgcgcggggcgggacgtgggcg
ccgataagtgccggcgccgcggcggcgaggctgaagtggcgttgctgctgccgataacgc
gcgttgtgacttggcacaaacttgggtgccgacggcaagtagggcagccgagtcgcacca

 1.02 Intr +   1730   1831  102  2  0   18   86   145 0.630   5.67
aaccttcccggacgcgcggggcgggacgtgggcgccgataagtgccggcgccgcggcggc
gaggctgaagtggcgttgctgctgccgataacgcgcgttgtgacttggcacaaacttggg
tgccgacggcaagtagggcagccgagtcgcaccagcgccccctccacgcgccgcgcccag
CAAGCGAGTGGTGGTAACTCGATGGCGGTCCCGGAGGCGCGGACACTTTCCTCAGCCCTT
TCGTTCTCTGTGGCGTTTCGAATGGCTATTTAACGAGAGAAG
gtgcgggccgcgctctgcctttcaccccgagcagcgggtctgaaaaccagaggtctgtgg
agccgactttgcatttttccttcaactcttgcgactttcttggtctgcctgtgtggtttt
aataaaatacagcatccgttgtgaccgcttcctttgcaccggcgctctgttaccttgtgt

 1.03 Intr +  13972  14184  213  1  0   95   92   139 0.750  11.91
tgataaatctataaatctatagatgtagcctatataaatttctaagtgatgtttctactt
ttgtgattgtatataagctaaatttgaatatctaccaatgggtatttggaaatttcattg
aaatctgccatctctggaaagttgtcaactttaacagtgaatgtttttgtttaattctag
GGGGAAATTTGCAGTGGTGAGAAAATGTATAAAGAAAGATTCTGGGAAAGAATTTGCTGC
AAAGTTCATGAGAAAAAGAAGAAAAGGCCAAGATTGTCGGATGGAAATAATTCATGAGAT
TGCTGTACTTGAACTAGCACAAGACAATCCTTGGGTCATTAATTTACATGAAGTTTATGA
GACTGCATCAGAAATGATCTTAGTTCTGGAATA
gtaagtattgtctttcttagattaagtttgtttggtagtctacacttcctttacggaatg
ccactcatctgtgataatgttgccaggcctggttctctggaaatctcagaattttctaga
tcatcttcaggtgttcctcttattaatataacatgttccaaatttgcaaggatgcatgta

 1.04 Intr +  26331  26475  145  0  1   68  116   149 0.991  15.06
gtttgagaccagcctgggcaacatagtgaggtcccatctctatttttcaaaataaaaata
cattttttaaaaaaggtatacagttactgccagactgtaattaatttactctgtagtttt
ggtgtaagtgttcgccatttcttatgagttatatattactttaattttgcccttctctag
TGCTGCTGGGGGTGAAATCTTTGACCAGTGTGTTGCAGACAGAGAAGAAGCCTTTAAAGA
AAAAGATGTTCAAAGACTTATGCGACAGATTTTAGAAGGTGTTCACTTTTTACACACTCG
TGATGTAGTTCATCTTGATTTGAAG
gtaagattcaaattacaattttgagattgctaaagaatgacattcaagacataaaatatt
taacagtgatttattcaaacatgtttcacgtttgtgtattattaggtaacaaggatatta
gaattgagtctttactcctatcctctagccagttagttttatcagggagataatgcacac

 1.05 Intr +  37673  37799  127  1  1   53  106   146 0.850  12.23
gtacaggcctgctgccttatacataggcaataaattgtaaaaatatttctttaacaaatg
actgtttactgttaaattcctcagtctcagtttcataggtgaaatatgttttatgggctg
catgttttgtgtacttaatcatagttatattgatttttgcgggggtgtattttcttttag
CCTCAGAATATTCTGTTGACAAGTGAATCTCCATTGGGTGACATTAAGATTGTTGATTTT
GGCCTTTCAAGAATATTGAAGAACAGTGAAGAGCTCCGAGAAATTATGGGTACCCCTGAA
TATGTGG
gtaagtattcataaaagtagttttgttctggggtcaggcatcaccttcattaggggactt
gtccatgtggcatgactcatagtggagccagctatctactatgttgaaattctaccatca
gagatctattcctttggattacattttacaatggaaaacgttcaagagtaagataccaaa

 1.06 Intr +  41839  41965  127  2  1   52   80    81 0.509   2.52
tcttagttatgatcctataagcatggcaacagatatgtggtaagagttattaatgaaaaa
ttgatcaaattagtttcaagaaatgagtatggtactaaatttttcttgcattttctttct
aatttaggagcattggagtgttaacatatgtcatgcttacaggaatatcacctttcttag
GCAATGATAAACAAGAAACATTCTTAAACATCTCACAGATGAATTTAAGTTATTCTGAGG
AAGAATTTGATGTTTTGTCTGAGTCGGCTGTTGATTTCATCAGGACACTTTTAGTTAAGA
AACCTGA
gtaagtattatttttattagtttaatattgaactaattcaatattaaaaaattcagtatt
aaaaaactgacagttttttcttgaatctcctccaaccaaaaatagttcaacttctaaaac
accataatggaaacacaaaaatgttgacataaatctaggtgaaacccttggcttaatata

 1.07 Term +  42595  42919  325  1  1   65   53   393 0.996  26.75
tcagcattgtgggaaattgcacccaaattccaagactaatagttttattcaggaatcaca
gtaagatttttgccaacttgtcagacttcccaaaatataatgcaataaatacagtacctt
atgctctaattttaattgaagttctaacatgtcttaactgtaaaacatgtatctttacag
AGATCGAGCCACTGCTGAAGAATGTCTAAAGCACCCCTGGTTGACACAGAGCAGTATTCA
AGAGCCTTCTTTCAGGATGGAAAAGGCACTAGAAGAAGCAAATGCCCTCCAAGAAGGTCA
TTCTGTGCCTGAAATTAATTCGGATACCGACAAATCAGAAACCGAGGAATCCATTGTAAC
CGAAGAGTTAATTGTAGTTACTTCATATACTCTAGGACAATGCAGACAGTCTGAAAAAGA
GAAAATGGAGCAAAAGGCCATTTCCAAACGATTTAAATTTGAGGAACCTTTGCTACAAGA
AATTCCAGGAGAATTTATCTACTGA
gcaatatttccctttagaacttcaagatttctacattgaaaatgttaatattatttatgg
acctctggccaaatggtacatgtactggaagtggataaccagtatcacttacacaaacaa
aaataactttgtcaaatttgtggagttaggtggaagccagattttaaaagttgccaacca

Predicted peptide sequence(s):


>STK17A_1|GENSCAN_predicted_peptide_1|414_aa
MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYS
LCPGRELGSKRVVVTRWRSRRRGHFPQPFRSLWRFEWLFNERRGKFAVVRKCIKKDSGKE
FAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEI
FDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIV
DFGLSRILKNSEELREIMGTPEYVGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRT
LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSE
TEESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFIY