GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:18:39

Sequence SRPK2_1 : 155048 bp : 40.04% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.08 PlyA -    157    152    6                               1.05
 1.07 Term -   1698   1595  104  1  2   72   42    67 0.259  -2.04
 1.06 Intr -   7504   7375  130  1  1  110  116    39 0.367   8.25
 1.05 Intr -  25064  24917  148  1  1   62   91   137 0.218  10.72
 1.04 Intr -  25596  25330  267  2  0   -5   37   324 0.528  13.72
 1.03 Intr -  48786  48631  156  2  0   92   82    76 0.708   5.60
 1.02 Intr -  53887  53800   88  2  1   64   76    45 0.048  -0.99
 1.01 Init -  63781  63652  130  1  1   76  103   102 0.950  10.86
 1.00 Prom -  63935  63896   40                              -5.05

 2.01 Init +  65707  65719   13  0  1   62   92   -11 0.551  -2.81
tgccccaaggaatggcactcacatgtcgggcaactgaccctcagagcaacctttccacag
cagccgtcatcttcagcgcacgcattcagtggtagttttattagtgggatagcttaaggg
agagatgtgcttccggcatccagattgagactgtagggtcctatttccccgcactggggc
ATGGTTAGGAATA
gtaagtgaatcccattatgaaccattctcctcatagagccctgaaagggaataatctcaa
tcaatcaaacacacacacacacaccgcttccagaatacattcaaaacttcgaacaggcct
tatagaagtacaagaatctttctggcaatcttgtatattttagctacagtgtatgttaat

 2.02 Intr +  66489  66655  167  1  2   50   57   185 0.392  10.36
tgacaagttttattttttcccccatattaagaagtgctcaaatgcatccataatgcaaga
tgtacttctaagtaaatagcaattttctctctgctctttcaggccggagcctcaacagaa
agctcctttagttcctccttcctccaccgccaccaccaccaccaccgccacctttgccag
ACCCCACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGG
ACCCTGCGGACTACTGCAAAGGTGATGTGCCAAGCATGGTGGTGTGGGGCTTGCCTTCCC
CATTGGGCTGTGTAGTAATTTGTTGGGGGAATGGACAAGGGGAGGAG
gtagtgatgcaaattgcttggtcttcattaaattagcctccttgtgtcattatcatttta
aattcttaggtcattgtatagagactgatatcagaaaatattaagtgatatgagagagaa
ttgtaagacaaaatacatgtatttgtacatacatattctaggtactttcagaaggactta

 2.03 Intr +  68830  68910   81  0  0   72  111    60 0.744   5.62
gtcttgttcatctggatcttaagtatgtgggtcaggagatgtaaccaatactctcatccc
cttactatctctgggaaccagcacagtggacatccaaaccccaaatatagggctaagaat
aaagtattccacagccggggctgtttctaggtaacattcactgaactctaaccttcacag
AGTATTAAAGTCAGCATCAGTAAGGTCATTAGAGATAGTAAGGTTCCCTCCTTATACCCG
TGCCAGCCCCCCCCAAATTTG
gtaagtaacttgtacctttagttagcattacatgtgacagatgccctactttgaattttg
tggtatattccacaacagtttgtataagattactgacatatacatattcagggagtccaa
ggaattgatttggaatgtctggaataagacctgtggccttctcattttttgttcttggat

 2.04 Intr +  76539  76755  217  2  1   32   56   162 0.183   4.55
agctagttacatctggattgtagggttttggtttttgtcttctttacctctttgtattgg
ttttctttgttttctgcattgagcatatatttctttgtaaatacagaagaatatgtgctt
ttactgctgaaagaaatcatagacgacacaaacaaatggaaacacatcccatgctcatag
GTGGGTAGAATCAGTATTGCGAAAATGACCATACTGCCGAAAGCAGTCTACAAATTCGGT
GCAATTCCCATCAAAGTACTACCGTCATTCTTCACAGAACTAGAAAAAACCATCCTAAAA
TTCACATGGAACCGAAAAAGAGTCTGCATAGTCAAAGCAAGACTAAGCAAAAAGAGAAAA
TTTGAAGGCATCACATTACCTGATTTCAAACTGTACT
gtaagagcacagtcaccaaaacagcatggtactggtataaaaataggcacatagaccagt
ggaacagaatagagaactgagaaataaacccaaatacttacagccaactgatctttgaca
aagcaaacaaaaaagggaacagacaccctattcaacaaatggtgctgggaaaactggcaa

 2.05 Intr +  80746  80808   63  2  0   92   36   125 0.192   5.47
ccatctaatttttgtatttttggtggagactgtgctttgccattttggccaggctggtct
agaactcctggcttcaagtgatctgcccacctcagcctcccaaagtgctgggattacagg
tgtgagccactgcatccggccgagattcttttttctttgcttacacttccttctcctcag
CTGGAGCAGCTGCTCTGGACAGGGCAGGACCTACTGTTGATGCAGCAGCAGCTGCTGGAG
CAG
gtccaccaacccctacattaggatgagtctctcgatgtcaccataggccagggcctttgc
caacaaaccaggccgaaaaggttcaacatttacaccacctactttaattagggccttgat
ttatcctctgtgacggtcacctcgttcatagtgaagaatgagggtggagtagatgcaggc

 2.06 Intr + 100942 101050  109  2  1  103   92    25 0.070   2.82
caacactttttcttgttgaaagatattcctgaaaaaaatgttgtattattaaacatgttt
tagtctgcatgtattatgtagagctttctttaatgacatcaagaatgacaaaagagatga
aatgtttattactacttttcgaatattttgaatttttttctttctttcttgttttttaag
GTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGGTATCATGTTATTAGAA
AGCTTGGATGGGGGCACTTCTCTACTGTCTGGCTGTGCTGGGATATGCA
gtaagtgttctttgtcatttgtgcatttgtttcctggagtagttcaacatctgtgttcta
agaaggtatggctgagggtcaccactgctttgttgaggtatgtgaagtgcttagcacagg
cctgcctcagctggctagattccttcctgccccctgccttagtttgaagttcatttgaaa

 2.07 Intr + 104131 104321  191  1  2   29  101   131 0.166   6.81
attcacttactttagttgttcagtttcagattaatttgctcaatttacatttttctgttt
cttgttagactatgatccacagagtatttaaattatcctgacagaagttagtgattctta
acagaggaaagtgtttcttggtcagctataagtgtaggtgtttctcatgttttttaaaag
GATGGATGGCCTTAGTCGTAATGTGTCCGTTTCCTTCTGGTGGGTTCTTGGTCTCACTGA
CTTCAAGAATGAAGCTGCGGACCTTGCAGTGAGTGTTACAGCTCTTAAAGGTGGCGCATC
CAGAGTTGTTTGTTCCTCCCGGTGGGTTCGTGGTCTCGCTGACTTCAGGAATGAAGCCAC
AGACCCTCATG
gtgagtgttacagctcttaaagttggtgtggacccaaaaagtgagcagcaacaagattta
ttttgaagagtgaaagaacaaagcttccacagcatggaaggggacccaagcaggttgctg
ctgctggttcgggtggccagcttttattccctcatttgtccgtgcccacgttggagaaat

 2.08 Intr + 109594 109700  107  2  2   57   94    80 0.423   4.51
aatgtcagttcttgttatttaagtgagatacaacattttctcacttttggtattactgat
agggttgatgttgtattttataaagtaataagtgctttgcaagtgacacaatggtgctgc
tttcaataactgcctcactccaggcagtgcatccacaaacgatccttaactgtgtcccag
ATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATCCA
ACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAG
gtgagacttttgacagcagcccctaggccctagtacctaattggttaggctttcaacatg
aatgctgtttacaaatatgtatatgtattacatatgtatcagtgcataatgtatatatgt
tatgtatgttacatatgtatcagtgcataacattttgaactcttattaagtcagtattta

 2.09 Intr + 123550 123715  166  0  1   69   94   139 0.733  11.21
tatggaaaggagagctggattccaatgtgggtaggcatgggagggagatttttactaaat
atccttttgtgtttatcaaactttgtaccctggcattgtattacatgtttttcaaataaa
taaaagttatataatgagatattaatagcttatcttctctcttgattttactatatccag
GTCCTTCAAGGGTTAGATTACTTACACAGTAAGTGCAAGATCATTCATACTGACATAAAG
CCGGAAAATATCTTGATGTGTGTGGATGATGCATATGTGAGAAGAATGGCAGCTGAGGCC
ACTGAGTGGCAGAAAGCAGGTGCTCCTCCTCCTTCAGGGTCTGCAG
gtgagggagctgagccagcttcatttcagtgtgggggcattgggagcttgcaaagttgca
gttgttgaaggtatctgaatcaaacgttacacataaggaagattttggaaaagtttaatt
gctggaaataactgcacccttgaaatggaaaatgccccagctacattatattttaatatt

 2.10 Intr + 124900 124925   26  2  2   41   95    26 0.822  -4.57
tttgtttcagtggcataaacttactctagatccttgtgattaagaagctctgattaatag
tttttgaagttggatagccattaaaagacaataattatttcactttgcaattcgaatgac
ctacatgaaggcatgtgtctgttttctgctaaatacagattttgtttgattttattttag
TGAGTACGGCTCCACAGCAGAAACCT
gtaagtacttacgcatattactttatatgcaccatgttaaaagagaccgtttattattga
gttgttcaaattataaaaaagttgtgtatttaaagggtagacacatttataaaagctgtg
tatcctcaaataggtaagacttaatgtcttgttaattttttttttttttttttttgaaaa

 2.11 Intr + 126878 127124  247  1  1   68   61   187 0.850  10.11
tgctttccctttgattttatcgtaagccttaccacaaagtggatctgtctgggtttggga
ttttaatagaatatggcatgagaaagcagagtttattgctatttgccatgctgctagtcg
ttatactatcgtggtgctttaaaaagaagaatactgacctgtggtctttccttaacatag
ATAGGAAAAATATCTAAAAACAAAAAGAAAAAACTGAAAAAGAAACAGAAGAGGCAGGCT
GAGTTATTGGAGAAGCGCCTGCAGGAGATAGAAGAATTGGAGCGAGAAGCTGAAAGGAAA
ATAATAGAAGAAAACATCACCTCAGCTGCACCTTCCAATGACCAGGATGGCGAATACTGC
CCAGAGGTGAAACTAAAAACAACAGGATTAGAGGAGGCGGCTGAGGCAGAGACTGCAAAG
GACAATG
gtcagtggggcctggaacctgggctgcatggggttctcagagctccattagtagggttct
gccaggtcaacatgggggctgatttgtgctgctgctgcagatgacaaggatgattctctc
caactccctattgggaaatatgggaaatagcctcgtacttcatttgtgaactgtatgcca

 2.12 Intr + 127718 128200  483  0  0   43  115   605 0.994  50.77
ctaaatgaatgaaaaatgagatttagaaaacctgaaggttttaccccaaaagccaagagg
tgtttaccaggtggtacataagcatattcaaaatgtattttattgatggagataagtact
taatgaggctgtattaaggagagtaacaagttctaattcttgacccatcaaattcttaag
GTGAAGCTGAGGACCAGGAAGAGAAAGAAGATGCTGAGAAAGAAAACATTGAAAAAGATG
AAGATGATGTAGATCAGGAACTTGCGAACATAGACCCTACGTGGATAGAATCACCTAAAA
CCAATGGCCATATTGAGAATGGCCCATTCTCACTGGAGCAGCAACTGGACGATGAAGATG
ATGATGAAGAAGACTGCCCAAATCCTGAGGAATATAATCTTGATGAGCCAAATGCAGAAA
GTGATTACACATATAGCAGCTCCTATGAACAATTCAATGGTGAATTGCCAAATGGACGAC
ATAAAATTCCCGAGTCACAGTTCCCAGAGTTTTCCACCTCGTTGTTCTCTGGATCCTTAG
AACCTGTGGCCTGCGGCTCTGTGCTTTCTGAGGGATCACCACTTACTGAGCAAGAGGAGA
GCAGTCCATCCCATGACAGAAGCAGAACGGTTTCAGCCTCCAGTACTGGGGATTTGCCAA
AAG
gtaagtgtttcttcccatcaactgtctgccatcgctgactccagggacgtgcctttaaca
aatgctgtgaaggaattggctggaagtggccaagccctgtgtgtgtgtactgatcagttt
tattacttttatactcctgaagaagtaatgtgatttaaataaattttctatgccattagg

 2.13 Term + 128930 129057  128  0  2   63   49   137 0.938   4.76
ttgtgttcttgtctacctaagaaggcttgacttattcaaagccttattttgggagtgaat
gccaagtgactctagtaagtgaaaactgggtaacacagctggtttccatactggcttatg
ggggaaaagctctgaaacctccctctgctccctctactgacaagactgtttaacacacag
CGAGTAAAATTGATGAGCCAGCCCTGCAAACAGCCCGACATTCTGCAGCCCCTTTGGTTC
CAGCAGTCTGGAATTGCACGCTGAGTAAGCTGGCTTTGTTACGCACTGGCTATGATGAAT
CCTCCTAA
ggatttgctttctttacttggctggacgtggtcagctcctgttcccctttccagggagtg
tttgaaggtgcttacatagaatgtaggttaatttctgggaaagggcagtagtgagaggta
ccttatccagacttattgttgctgttgcagttcaatttttctcttacttgaagtttcttt

 3.01 Init + 135383 135665  283  1  1   45   82   130 0.864   5.35
cttcttttttggtctttgtgctgctttctttctgaatttttgctgagttctggtgtttct
tttcctgagctcatacctggcctttggtgaggctgtgcagaatccttataaagaaggaaa
caggcatatggaaggtagcaagcagggaatatctgtacctggctggctcatttgattaac
ATGCTAGAGGAACAGGTCTTGAGGGTTAAGATACTGGTCAGAATTCTCTTGGCGTCCTCT
GGAGCCCCCCTAGGGAGCTGTGTGGGCACCCTAGGTCCTGAGGCCCTTGCCTGTTCACTG
CCTTACGGCAAGTTGCAAGGCTGGCCCTCCTTCCTCTTATGGGGCTTGCTGAAGAATCAG
AGCCTCCCCAAGCACCCTGGTTTCACAGCTCGTATGTACCCCAACAGAGGTTTAGTTCAT
TTCAGCAGTGCCCAGCTTCAAGGAAACAAAGGGGCTCTCCTAG
gtaggtgtttatattagtctgttctcacattgctgtaaaaaataccggaaacccggtagt
ttataaagaaaacaggtttaattggctcacagttccacaggctgtacaggaagcatggct
ggggaggccttaggaaactttcaaatatggtagaaggggaagcaggcatcttacatggct

 3.02 Intr + 137104 137204  101  2  2   53  103    82 0.919   5.11
attttccagaggtggagaacaagcaattttagttctgtcaagtttaatttacagtattcc
aggcctaagtgatcattccactactcttgaggaaaggagactgaccctggcaaacactgt
gctcacacatgcaaaccacctatcccgatcactaactgtcctgctgtttgctcatgccag
CAAAAACCCGGGCAGCTGACTTGTTGGTGAATCCCCTGGATCCGCGGAATGCAGATAAAA
TTAGAGTAAAAATTGCTGACCTGGGAAATGCTTGTTGGGTG
gtaagtagagttttctttctaaaacctttggtcttgattctgtgtgcgaagacacttttt
gaatgtctgtgttgctccgtggtaatgcagcctgttcccttccagcataaacacttcacg
gaagacatccagacgcgtcagtaccgctccatagaggttttaataggagcggggtacagc

 3.03 Intr + 137310 137417  108  2  0   72   91   165 0.770  14.76
gtgaatcccctggatccgcggaatgcagataaaattagagtaaaaattgctgacctggga
aatgcttgttgggtggtaagtagagttttctttctaaaacctttggtcttgattctgtgt
gcgaagacactttttgaatgtctgtgttgctccgtggtaatgcagcctgttcccttccag
CATAAACACTTCACGGAAGACATCCAGACGCGTCAGTACCGCTCCATAGAGGTTTTAATA
GGAGCGGGGTACAGCACCCCTGCGGACATCTGGAGCACGGCGTGTATG
gtaaggacggctgtgccctttgctgccatgggaattggctcgttcctttcacactctgga
tggggctgagtctctctgaggcatgcgacctcagtttttctgactgtaagggtcatccac
cgtgggctgggtgaggggaaggttgctgccgcaggcatcttaagaagtggaaggatcctc

 3.04 Intr + 143157 143226   70  2  1   64  113    64 0.853   4.34
atacttctgaaacttctttgaatgtggaagaaagaaaaaaattagtattgagcactttca
ggaggctattttgtttgattcagatcttcataaagtggcggtctcttctataaggagaaa
aagctgttgacttgggggccagtctctgaagtgcttagcatgtcgtctgttgtatcctag
GCATTTGAGCTGGCAACGGGAGATTATTTGTTTGAACCACATTCTGGGGAAGACTATTCC
AGAGACGAAG
gtgagtattggtgcctgctgaatacctcggtctaggtcttctgccagccctgaacttctg
tagagtactgtatttttgtactgaaatagagccatgtgtttggttttcaaacaccaaatt
cagatgcttttcctttgagtttgatgccccctcagtctcagtgaatgggcagagcctgcc

 3.05 Intr + 143879 143971   93  0  0  122   52    52 0.799   4.02
ctgctccaggtggtgcctgaggcctgccattcccacaagcctctgcatggatgtgctgca
gacactgttgatttgaatctatttctgattttttactaatttcaatttttccctcttctt
ttatcccatccttccctttgcccctcccattcccatatcctttttttctctcctccatag
ACCACATAGCCCACATCATAGAGCTGCTAGGCAGTATTCCAAGGCACTTTGCTCTATCTG
GAAAATATTCTCGGGAATTCTTCAATCGCAGAG
gtagtacctcttctttttgaaaagcgccacgatgcagacagaaactgaagagcagctgct
gattttagcattaatggtgacaaaggcatttctcctaaattcgaaacgcaacccagcaga
attcctatgctgatagaaaaattgtcagggaagaccacatttagccctgtgctgcggtca

 3.06 Intr + 144186 144437  252  1  0  109   92    78 0.571   6.78
cagacagaaactgaagagcagctgctgattttagcattaatggtgacaaaggcatttctc
ctaaattcgaaacgcaacccagcagaattcctatgctgatagaaaaattgtcagggaaga
ccacatttagccctgtgctgcggtcaccctgttcaccagcccctctcctgtgccctccag
CTCTGGATCCTGAATCCAGCAACGCGAGGAAGGCCTGTACTTTTGGTCATTCAAGTTGCG
CTCTGTTTCTGTCTGCGCGGGCGGTGGTAGTGTCTGCATGCAGTGTACTGATTAAACTGT
CGTGTGTTTCTGTTTTGCTGGCAATGTTTCCCAATGCAGATCACATAGCATTGATCATTG
AACTGCTGGGGAAAGTCCCTCGAAAATACGCTATGTTGGGGAAATACTCCAAGGAGTTTT
TCACCAGAAAAG
gtaacggtatttatgcaacactaattttcagcatagtcttctcccaaaaggagaaattgt
gcattcgtgattgggcagtggagaaagatctggagtttcacaactggggaattcttccga
agaaagctctcaagaaataaacctgacccatctgatacctggagtaagaattttgtaaga

 3.07 Term + 152202 152386  185  1  2   94   43   227 0.984  15.52
cttggtcatatgtacatgtaatgattattgcttagtggggaaaagctggtgttctttgtt
gttgctgtacaagtgttgagcaggtggttgtccgcttcactgaaaagaacctgactggac
caacaatggggaatgcagatttggagctttcttgacattggcctgttttttcccctgtag
GAGAACTGCGACACATCACCAAGCTGAAGCCCTGGAGCCTCTTTGATGTACTTGTGGAAA
AGTATGGCTGGCCCCATGAAGATGCTGCACAGTTTACAGATTTCCTGATCCCGATGTTAG
AAATGGTTCCAGAAAAACGAGCCTCAGCTGGCGAATGCCTTCGGCATCCTTGGTTGAATT
CTTAG
caaattctaccaatattgcattctgagctagcaaatgttcccagtacattggacctaaac
ggtgactctcattctttaacaggattacaagtgagctggcttcatcctcagacctttatt
ttgctttgaggtactgttgtttgacattttgctttttgtgcactgtgatcctggggaagg

Predicted peptide sequence(s):


>SRPK2_1|GENSCAN_predicted_peptide_1|340_aa
MDDPQNSQTLQSKCVGTSHSSSEGHTEQADRKLLKSQLYQMKSDILSTGWSNKPIMVVSR
KRNSVTGEMKERSYNSPHALLESRQESTLPDDLVYESLYIFSGISNQYHTNAKCYFGPNH
TYLPSPSAPGPPLESSSPGSALPYGRGPQQGPKGDQERERAQAQPPPRASDQTHQVCAGH
DPGGMWLRPVQAARQGVTERSPKTNGSSSSSRKGPKNVLGTRNVNMRQLKLLASRASGVR
STESQYKGLDGALGGSRTLCSGMERSCSEIVQFLLLILLKMVQTLGNTGRATRMLTRKKE
GRNGGKAKLFLKPSTAVTHEPAVCCVMVCMLQLIRLHYFS

>SRPK2_1|GENSCAN_predicted_peptide_2|665_aa
MVRNNPTPPEPEEEILGSDDEEQEDPADYCKGDVPSMVVWGLPSPLGCVVICWGNGQGEE
SIKVSISKVIRDSKVPSLYPCQPPPNLVGRISIAKMTILPKAVYKFGAIPIKVLPSFFTE
LEKTILKFTWNRKRVCIVKARLSKKRKFEGITLPDFKLYSGAAALDRAGPTVDAAAAAGA
GGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQMDGLSRNVSVSFWWVLGLTDFKN
EAADLAVSVTALKGGASRVVCSSRWVRGLADFRNEATDPHDVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQ
KAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERK
IIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIE
KDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN
AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQ
EESSPSHDRSRTVSASSTGDLPKASKIDEPALQTARHSAAPLVPAVWNCTLSKLALLRTG
YDESS

>SRPK2_1|GENSCAN_predicted_peptide_3|363_aa
MLEEQVLRVKILVRILLASSGAPLGSCVGTLGPEALACSLPYGKLQGWPSFLLWGLLKNQ
SLPKHPGFTARMYPNRGLVHFSSAQLQGNKGALLAKTRAADLLVNPLDPRNADKIRVKIA
DLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSG
EDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRALDPESSNARKACTFGHSSCAL
FLSARAVVVSACSVLIKLSCVSVLLAMFPNADHIALIIELLGKVPRKYAMLGKYSKEFFT
RKGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPW
LNS