GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:11:10

Sequence SERPINE1_1 : 14254 bp : 50.72% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1154   1274  121  0  1   37   91    96 0.289   4.35
acacatgcctcagcaagtcccagagagggaggtgtcgagggggacccgctggctgttcag
acggactcccagagccagtgagtgggtggggctggaacatgagttcatctatttcctgcc
cacatctggtataaaaggaggcagtggcccacagaggagcacagctgtgtttggctgcag
GGCCAAGAGCGCTGTCAAGAAGACCCACACGCCCCCCTCCAGCAGCTGAATTCCTGCAGC
TCAGCAGCCGCCGCCAGAGCAGGACGAACCGCCAATCGCAAGGCACCTCTGAGAACTTCA
G
gtaggagaaaagcaaactccctccaacctcttacttcgggcttaaggcagagaactcgcc
tccccagaatctcctccctccatgatcccccgctattcctctattttcttttcctcggac
ctgcagccttgggtcgaccctgccctaggggtgactgcaggagagcagggaggatggtca

 1.02 Intr +   2423   2718  296  2  2   84   90   280 0.305  24.45
gagtgggatgggcttagaacctgaacatgtcatggtctcttcctgcaccttgccctagtg
ttcacttaccacctgcttgcaggaaacaagaagagcagggcccacagctggccagctccc
ctcccctcccgcctgtcttccagaacgattccttcaccagccctctttccattgctctag
GATGCAGATGTCTCCAGCCCTCACCTGCCTAGTCCTGGGCCTGGCCCTTGTCTTTGGTGA
AGGGTCTGCTGTGCACCATCCCCCATCCTACGTGGCCCACCTGGCCTCAGACTTCGGGGT
GAGGGTGTTTCAGCAGGTGGCGCAGGCCTCCAAGGACCGCAACGTGGTTTTCTCACCCTA
TGGGGTGGCCTCGGTGTTGGCCATGCTCCAGCTGACAACAGGAGGAGAAACCCAGCAGCA
GATTCAAGCAGCTATGGGATTCAAGATTGATGGTGAGCCACGGGACACCAGGGGAG
gtgggtggcatgcagaacagacctaccagaagccaaggaaaggctggctctggcttagcc
gagccaagccccatacagctgtgctgcaggggccaccccatcttcttcccactacactcc
aagtcactggacccttgaatctccaagggtgtctgaccagtagatttaccgcttattcac

 1.03 Intr +   4451   4684  234  0  0   93  105   298 0.999  29.66
aggaaggagatacagaaaagagatttcatcctggaatgaaatctccctccagagagccct
gggaaagcacggtagcccccatccatcagagtggagccccttgtgggggaagtgggctcg
gctgggaaccctcaattcagcataagcctcacatgtcctctcctctctgtcccggtgcag
ACAAGGGCATGGCCCCCGCCCTCCGGCATCTGTACAAGGAGCTCATGGGGCCATGGAACA
AGGATGAGATCAGCACCACAGACGCGATCTTCGTCCAGCGGGATCTGAAGCTGGTCCAGG
GCTTCATGCCCCACTTCTTCAGGCTGTTCCGGAGCACGGTCAAGCAAGTGGACTTTTCAG
AGGTGGAGAGAGCCAGATTCATCATCAATGACTGGGTGAAGACACACACAAAAG
gtgagcaggcagggaaaggaaacccatttcctgggcctcaagagaaagggaatttggaaa
taaatccacatatcccagttgggtgcagtagttcacacctgtaatcccagcccaacactt
tgggaggtctaggcgagaggaaggcttgaggcctggagtttgagaccagcctggccaaca

 1.04 Intr +   5905   6099  195  2  0   95   92   278 0.999  28.29
attcgggaggctgaggcaggagaattgcttgaaccccggagacagaggttgcagcgagcc
gagatcgcgccactgcactccagcctggcaatagagtgagactccatctcaaaacaacaa
caacaacaacaacaaaatcgtctaacttcctgatcttcctgatcattgattttcccatag
GTATGATCAGCAACTTGCTTGGGAAAGGAGCCGTGGACCAGCTGACACGGCTGGTGCTGG
TGAATGCCCTCTACTTCAACGGCCAGTGGAAGACTCCCTTCCCCGACTCCAGCACCCACC
GCCGCCTCTTCCACAAATCAGACGGCAGCACTGTCTCTGTGCCCATGATGGCTCAGACCA
ACAAGTTCAACTATA
gtaagtccaagagccccttccccacagcccacagcaactgcatctcattcctggggtctc
ccaaggaatacccaaaatgtcaccctctgagggaggaagaccacagggaatgctcccctt
taagggaggagagaccctagaatatactccagctttgacaaagatttcccaagcaggaga

 1.05 Intr +   7725   7923  199  1  1   89   82   238 0.999  21.71
gaaattaaaatactgaataggggagcagtgaacaggggatacccaaaagccaagagcgag
agagagcctggcttccagaaatagtggagaagccaggagaactaggtgaaaacccagtgc
tgggttgccatcagcgagagctggagccatttccaacgaaccatcttgtcgtcttcacag
CTGAGTTCACCACGCCCGATGGCCATTACTACGACATCCTGGAACTGCCCTACCACGGGG
ACACCCTCAGCATGTTCATTGCTGCCCCTTATGAAAAAGAGGTGCCTCTCTCTGCCCTCA
CCAACATTCTGAGTGCCCAGCTCATCAGCCACTGGAAAGGCAACATGACCAGGCTGCCCC
GCCTCCTGGTTCTGCCCAA
gtaagccaccccgctatctccccgacctaccaacccctctctcctggctccctaaagtca
ccgcccccaggttgaatttcccagatctgtgatgcttgcaggacatgcatgtgtgggagg
ctgatgggaaactgtggcctgggtttgattatgagtcttgcaatcatccctccccctgtt

 1.06 Intr +   9524   9624  101  2  2   97  110    86 0.999  11.45
agaaagaaagaaaaagaaaggaaagaaagaacgaacgaaccaggcctccctctccaacct
tcacctccgtccctattctggccacttgattcgggggacacctggtaggggatggggaaa
ggtgggagctgccagccagaggggaccccggcttgagcagcctcttgctgctatctgcag
GTTCTCCCTGGAGACTGAAGTCGACCTCAGGAAGCCCCTAGAGAACCTGGGAATGACCGA
CATGTTCAGACAGTTTCAGGCTGACTTCACGAGTCTTTCAG
gtaagaagactttcctttgcattttctcaccccagtggactgcgggggcccctaagagga
aaaaggaacctctccttgagagcggcagctgatctaatcctgtatccacatctgtttcag
accaagagcctctccacgtcgcgcaggcgctgcagaaagtgaagatcgaggtgaacgaga

 1.07 Intr +   9745   9831   87  2  0   89  109   131 0.873  15.24
agaacctgggaatgaccgacatgttcagacagtttcaggctgacttcacgagtctttcag
gtaagaagactttcctttgcattttctcaccccagtggactgcgggggcccctaagagga
aaaaggaacctctccttgagagcggcagctgatctaatcctgtatccacatctgtttcag
ACCAAGAGCCTCTCCACGTCGCGCAGGCGCTGCAGAAAGTGAAGATCGAGGTGAACGAGA
GTGGCACGGTGGCCTCCTCATCCACAG
gtgagtctggctcaggtgaggctccacgggtgtcgcctccatcgcccttcaggataactg
gtccccagacccggaaaggaccccgcagccctctcggcacagagcagctctgtctgtgct
cagccatcacccactccccacctgtttctcagcctggaaaacgggcttgggaccatggaa

 1.08 Intr +  11031  11114   84  1  0  105   99   105 0.985  13.09
gactgaggtgggaggatcacttgagcccatgagttcaaggctgcagtgagccatgaaggt
gccactgcactcccacctgggcgacagagggagaccctgtctctaagaaaaacggcgggg
gtgggggtggtgccagtgccagcatccctctgttctaagacattgtcccttctcttgcag
CTGTCATAGTCTCAGCCCGCATGGCCCCCGAGGAGATCATCATGGACAGACCCTTCCTCT
TTGTGGTCCGGCACAACCCCACAG
gtgagcctggaacccatcacgttccacatcctcccacccattctttctctcaggaactag
tcccgacagatgcagacatccctctatccctgagagggctctgggcagggaacccataac
cctaccctgcttcctgtcccaagaggaggctaccttctatcacccacagacagtgccggg

 1.09 Term +  11258  11472  215  0  2   71   46    80 0.738  -0.51
agacccttcctctttgtggtccggcacaaccccacaggtgagcctggaacccatcacgtt
ccacatcctcccacccattctttctctcaggaactagtcccgacagatgcagacatccct
ctatccctgagagggctctgggcagggaacccataaccctaccctgcttcctgtcccaag
AGGAGGCTACCTTCTATCACCCACAGACAGTGCCGGGTCCCCGCTCTGTGACTCAGGCAG
CTGCGACTCCAGACAGCTCACTCATCTGCCTAGATCTCAGTCCTTCCACCCACATCCAGC
CTGATGAGCTGTCCCACTCCTTCTGCTTCTCAACCCCCATGGTTCTTCCACCCTCAGGAA
CAGTCCTTTTCATGGGCCAAGTGATGGAACCCTGA
ccctggggaaagacgccttcatctgggacaaaactggagatgcatcgggaaagaagaaac
tccgaagaaaagaattttagtgttaatgactctttctgaaggaagagaagacatttgcct
tttgttaaaagatggtaaaccagatctgtctccaagaccttggcctctccttggaggacc

Predicted peptide sequence(s):


>SERPINE1_1|GENSCAN_predicted_peptide_1|510_aa
XPRALSRRPTRPPPAAEFLQLSSRRQSRTNRQSQGTSENFRMQMSPALTCLVLGLALVFG
EGSAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQ
QIQAAMGFKIDGEPRDTRGDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQG
FMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNA
LYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPY
HGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRK
PLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAVIVSARMA
PEEIIMDRPFLFVVRHNPTEEATFYHPQTVPGPRSVTQAAATPDSSLICLDLSPSTHIQP
DELSHSFCFSTPMVLPPSGTVLFMGQVMEP