GENSCAN 1.0	Date run: 16-Jan-104	Time: 21:45:47

Sequence SEMA3C_1 : 179232 bp : 35.79% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 PlyA -    325    320    6                               1.05
 1.02 Term -   1911   1716  196  2  1   84   48   113 0.005   2.80
 1.01 Init -  38903  38845   59  2  2   76   72    55 0.139   3.53
 1.00 Prom -  56500  56461   40                              -6.05

 2.04 PlyA -  57485  57480    6                               1.05
 2.03 Term -  58694  58213  482  0  2   48   37   234 0.976   8.27
 2.02 Intr -  61187  61085  103  2  1   62   58    50 0.422  -1.77
 2.01 Init -  62407  62363   45  1  0   91  109    14 0.791   4.53
 2.00 Prom -  71365  71326   40                              -5.25

 3.01 Init +  76444  76495   52  0  1   70   75    34 0.145   1.67
ggttttgctgggagaactgttggatctcagtttatagcataacactggcactgtccaata
cgtttatttttaataagcaacttacatatttcgtatgtgcattaaaatttgaagactgca
gctatactcatgaaaagtgatggagaccaagtgcctcagctgagcatattctcatcctcc
ATGGGGACAGGAGAGTGTGGACACTGGCACTTAAATTCAAAATGTGGGAAAG
gtacccatgattcatctgcagtattcttatatatttaatggagaaaataataaaacttgg
ttaataacatttttgtagagagtaaatgaggtagtgcttgtaaactcttcttagacactt
tataggtactttgtatgttctcagtaggaattaggtagtgtgtggtaacttaaattaggc

 3.02 Intr +  91801  91961  161  2  2   80   84   121 0.938   9.69
ctcccaaagtgctgagattacagggaactagcccataactctattttaaaattaatttct
tactgtagaagaaaatgtaccttgacattttttggaatatttgcataatagtttttatta
aaataatagaattatagaaccaggatactgtatctacacttgtgctgttcactctttcag
AACTTCGAGAAACCAAGACCTCTGAATACTTCAGCCTTTCCCACCATCCTTTAGACTACA
GGATTTTATTAATGGATGAAGATCAGGACCGGATATATGTGGGAAGCAAAGATCACATTC
TTTCCCTGAATATTAACAATATAAGTCAAGAAGCTTTGAGT
gtaagtttatcactttcacgaggacagtgtccaccttttcaatgtctcttttttaaaaaa
aataaataagtaaaaaataatatgcattttattagaacaatagaaaatactggtcccatg
ttactatgaaagttagtacttatttcatggactgaaaaggtattaagttcagttctcatc

 3.03 Intr +  93059  93121   63  1  0   57  100    69 0.875   3.00
aataattgtaattgttaaaataatagaatctttattaatgaattgataaaaaagaaagaa
ttttaaagtcttagtgtaagatcaccttaaataaatctgttaacaaaaagtaaatgaaga
gcactgggctgtcatatgtccaagtgagattatgcaacctttatttttctttctgagcag
GTTTTCTGGCCAGCATCTACAATCAAAGTTGAAGAATGCAAAATGGCTGGCAAAGATCCC
CCA
gtaagtgttaaaaaaaaaaaaaaaaaaaaaaacactaacttaaatatttggttttcgaat
ccatgtactttgagggaagccaaaaatgagacaaggatggtggtgttttaaatttttgct
ggacacaggctaaaaacctaaaccttgaggagactggaactcttgggctctctgtaactt

 3.04 Intr + 102128 102247  120  1  0   64  107    57 0.035   4.97
acaattcttcttccagtgtggcctagggaagccaaaagattggacgcccctggactaata
catcaaaagtttatgtcacctcattgttacttatcatacaagatctcaggttaacatagc
taactgaaataacaatgaaagtcattgagttactaactgcttatttactgattcttttag
CACGGCTGTGGGAACTTTGTCCGTGTAATTCAGACTTTCAATCGCACACATTTGTATGTC
TGTGGGAGTGGCGCTTTCAGTCCTGTCTGTACTTACTTGAACAGAGGGAGGAGATCAGAG

gtaagtataactatttaacattcttagttttgatattagtgtcaaggatttttgaaactg
tattttagagtaaaaacttggacatatcaatattcataaaatattttcatgccctttaaa
tacaaactatattacattttttcctgtctgccaagttacttgaagtatcaccttttgcct

 3.05 Intr + 109845 109935   91  2  1    5   89   102 0.021   0.65
gtaattacagatcgattcttctcatagtttgagtaaatcttaatgtagtaaattggaagg
cataataagcaaccaactagaaagcatattaattttaatgatgctttgttttactaatga
acaattgtcttcactaaataagttatcattgccacattttaaattttatctacaataaag
GACCAAGTTTTCATGATTGACTCCAAGTGTGAATCTGGAAAAGGACGCTGCTCTTTCAAC
CCCAACGTGAACACGGTGTCTGTTATGATCA
gtaagtagacaacgaaagagggaggattaaacataaaataacatggaaaattagcttgac
atggtatacctattcttgatggttgtgtggatgatagtatgtgagtaaaataatatgaag
aaagttgtgagctgagaaatagagagttcagtttctcatttgtaagaatatttatgatta

 3.06 Intr + 114788 114907  120  0  0   89   83    74 0.890   6.55
gaaaagattaaaatttataaaatttattgatttgctggacaatgcaaaccaattaatatt
tgttataaccaattatcataacactgtaatacctgtggtgatctcctaataaataaactc
acctagaatttcaaaatagctttaaaaatttacatttcattgatattttctttttcatag
ATGAGGAGCTTTTCTCTGGAATGTATATAGATTTCATGGGGACAGATGCTGCTATTTTTC
GAAGTTTAACCAAGAGGAATGCGGTCAGAACTGATCAACATAATTCCAAATGGCTAAGTG

gtaagaaagcatttgatgcatttattttttagtatcgtgttaaactaacttatttaattc
tatcctaacaactagggaaaatggttaaaaactaaaatagcaggctattacatgaataat
ggtaattctgtaccctatgatttaaaatattcggggaaaataaacaattgaatagctcat

 3.07 Intr + 116298 116440  143  1  2   83   95   118 0.940  11.15
cgacattccaaatgtggcatggtgtgtgaatgcaattactgcttttagaaatgtgcctgt
aaatgttgaattgtttttttctaccaaagatggggaaggcatctgcctgtggtctacttg
gatgacagaagatggattttcataatgaatatatacctagtcttttacctttttttctag
AACCTATGTTTGTAGATGCACATGTCATCCCAGATGGTACTGATCCAAATGATGCTAAGG
TGTACTTCTTCTTCAAAGAAAAACTGACTGACAATAACAGGAGCACGAAACAGATTCATT
CCATGATTGCTCGAATATGTCCT
gtaagtattaatgctgttccgatttgaagaaagaccaagaaattcaaattatggtttatc
tccgtgcttttattatcaaccattacaaataaataaaatattgagggaagcatttaatgt
aacatttattcatcatcattattatatttaatattcatcattttatattgaatatagtgt

 3.08 Intr + 117767 117881  115  1  1   17   56   122 0.749   1.00
actattgtataaaatactataagtcataaatattcctctttgacaactgatgtgcagaag
tggttaacatatccattcttcagattttcatcctccaagcaactagagtacaagtcgaat
ttttaatgtgcttcaatatttacttaagcaatctgaattatgtttacaaaatggttttag
AATGACACTGGTGGACTGCGTAGCCTTGTCAACAAGTGGACCACTTTCTTAAAGGCGAGG
CTGGTGTGCTCGGTAACAGATGAAGACGGCCCAGAAACACACTTTGATGAATTAG
gtacatacatatgagattgaaaaatgcttctgaaagaaggcttgtaaagtttatatattt
aaataaggtctcaaaagaagatgtactttccatattttcagcataaataatatgctaatt
taaaataattatctagatactgttcataaattttcttaagtattttgtaatctgttacgc

 3.09 Intr + 125589 125692  104  1  2   92   94    30 0.447   2.97
ctctaaggttaagaatgttgcttctgaagtcctcccaatgaaggatcaactgtgattttc
ctactttatttccccctacagtagtatggttgcccagtcaaccccataaatatatggctg
tgttcttaaagaaatgagactggcagaaatctcataccctcgttctaatgttccctgtag
GTGCTTCTTTTAAAACACGGTTGGTAGCTCTGTTAGCAAACGACCCCACCAGCAAGCCCA
AGTCAGTAGGAAGAAGCCTGCCAATTGTGTCATTATATTTTTCC
gtaagtaattcaagtttgtggaagaaacaagacacttttggtatgttgcaaagggcagcc
aaagaatgaaaactctgtggccgagcaaacatattacattattctgctgcaacatgtata
aagcttctgcaggagattgtttgtatagttgtatatcctgttaaagcagaacttaatgaa

 3.10 Intr + 131018 131240  223  1  1   61   99   276 0.973  22.78
tgtactaatcatctacagatagtaaaacataatcatgttatttcttttcacttccatagg
tagcagatatacttaaaacaactggagcttctaagtgatttcaaaagtagagagtttttg
attattactagaacaagacaactattttattaacttggttctttaaaactttctttctag
TGTCCAGGAGGAGCATTTACACCCAATATGCGAACCACCAAGGAGTTCCCAGATGATGTT
GTCACTTTTATTCGGAACCATCCTCTCATGTACAATTCCATCTACCCAATCCACAAAAGG
CCTTTGATTGTTCGTATTGGCACTGACTACAAGTATACAAAGATAGCTGTGGATCGAGTG
AACGCTGCTGATGGGAGATACCATGTCCTGTTTCTCGGAACAG
gtaaatatttgagcccaagatatgctttaatgtgtagtaaaagaatgtactaaatatagg
tagtaggtaagggccatgatcttgaaactagaaaaactccaataattacgtctgtctagc
ccttagtgagatatttaatctctttttgcctcagtttcacatctgtaaaatgaagctaat

 3.11 Intr + 155303 155391   89  0  2   79   42    59 0.008  -0.83
tgtgtttcaatttttatgagatttggaatacattcagcacatggcagtggcttaatacat
acaatgttttttgattactaaatacttatgtaaataatggtccaagtcagtagtcctatg
tctaaatagctttcttttaaaaagtattgtaacatctcatttcttctttttttaatttag
ATCGGGGTACTGTGCAAAAAGTGGTTGTTCTTCCTACTAACAACTCTGTCAGTGGCGAGC
TCATTCTGGAGGAGCTGGAAGTCTTTAAG
gtttgaacatctcttctattaatctcagaacatgcatgatgagtggaattctttaatctt
acagccacttgggaggaaactatatttgataaaagatcaaataaatgaatgttatgaatt
tttgagggtaggaaaacaccagataaaataagaaatacagaacaaatatttttgcaaagt

 3.12 Intr + 162058 162215  158  0  2   55  101    39 0.008  -0.21
atattaatgtaggaaaattctatttattttggcttcatacccttctgtgctttgcttcat
gtttttaatcggttccaaaatgaatccaagggtttgtgggcatatattataatgtgttcc
tgctgaaagtcttcttttaacttccacatctgaaataaatcatcatcattcctttaatag
CAACAGTTGTATGTGAGTTCCAATGAAGGGGTTTCCCAGGTATCTCTGCACCGCTGCCAC
ATCTATGGTACAGCCTGTGCTGACTGCTGCCTGGCGCGGGACCCTTATTGCGCCTGGGAT
GGCCATTCCTGTTCCAGATTCTACCCAACTGGGAAACG
gtgagcactaaacactcggctcaacatccaaatgtaggacaccagacaatacagaagtgt
ttcacatctttagaattagttctattgctgtttccttaaatgacattaaaggtagaagct
atgtttaacaccacacatagtctttgaatgaagaaaatggtaatgtgttataacttgaga

 3.13 Intr + 169228 169304   77  1  2  111   61    42 0.417   2.04
ccattattgataaattgtataagaaatgtgagatagctgcatcaatcagaactcttttta
aaaaattttatgaaagcttagcaataaaaagggtgcaaagtttaaaattacagtgtttta
agagtggtgtaattggcagtgataattctcagtcacttttatgtatttctgcacttgcag
GAGGAGCCGAAGACAAGATGTGAGACATGGAAACCCACTGACTCAATGCAGAGGATTTAA
TCTAAAAGGTATTAAAA
gtgagcaatggccaatctcagtgaacagtagcaatgctccgtatcacatttcagtaaggg
gaaacattgtcatagattcaggcgtttcactttcaaaaatatttattataacaattctgg
gtatttatatagggtaattaaaacttaaaggctttttgtatgtatactgagaatcgtgta

 3.14 Intr + 171536 171666  131  0  2   76  105   115 0.988  11.49
cgggtgaacaacgtatcctattttgcttgttaaatgattaccactgttttttgctggctg
cgatagttgttcacaattttgtataaaaataaacatgtatatagcatttctacaggagaa
tgtgctctaaattcagttgtgttctttctttctctctcgccttttatttttgcctgctag
CATACAGAAATGCAGCTGAAATTGTGCAGTATGGAGTAAAAAATAACACCACTTTTCTGG
AGTGTGCCCCCAAGTCTCCGCAGGCATCTATCAAGTGGCTGTTACAGAAAGACAAAGACA
GGAGGAAAGAG
gtgagtaaagcagcacagcagcaatccatcagggcttcggagagaacattaaatcactgt
ccctcggcgaggctcagatcaaaggaaaaaggaaaggcatatgatcatcttttacgtctt
tgggatgacaagtgccactttccttaaaatcctttgtccttaagaattgatggattaatt

 3.15 Term + 175260 175673  414  2  0  113   34   394 0.991  30.78
ttaaaaaaaaaaaaggcaatggaactgaccaaaatttcatgtccactgagaaggatgcta
agtagtgctcaatacttttttcccaaatctgtgaaagttgagactattctgtgtatgttg
gtcataatctaaggaaatataatgttcagtttcagtaactttaatttgtctctcttttag
GTTAAGCTGAATGAACGAATAATAGCCACTTCACAGGGACTCCTGATCCGCTCTGTTCAG
GGTTCTGACCAAGGACTTTATCACTGCATTGCTACAGAAAATAGTTTCAAGCAGACCATA
GCCAAGATCAACTTCAAAGTTTTAGATTCAGAAATGGTGGCTGTTGTGACGGACAAATGG
TCCCCGTGGACCTGGGCCAGCTCTGTGAGGGCTTTACCCTTCCACCCGAAGGACATCATG
GGGGCATTCAGCCACTCAGAAATGCAGATGATTAACCAATACTGCAAAGACACTCGGCAG
CAACATCAGCAGGGAGATGAATCACAGAAAATGAGAGGGGACTATGGCAAGTTAAAGGCC
CTCATCAATAGTCGGAAAAGTAGAAACAGGAGGAATCAGTTGCCAGAGTCATAA
tattttcttatgtgggtcttatgcttccattaacaaatgctctgtcttcaatgatcaaat
tttgagcaaagaaacttgtgctttaccaaggggaattactgaaaaaggtgattactcctg
aagtgagttttacacgaactgaaatgagcatgcattttcttgtatgatagtgactagcac

Predicted peptide sequence(s):


>SEMA3C_1|GENSCAN_predicted_peptide_1|84_aa
MGTINCAYNWLHSSSSNELKCHRLKKQLEQGSQQGESFPDKPRVFLRKCPGLSIPMYEKS
IYRPKKLYFAKSVMRKMTNLAYRG

>SEMA3C_1|GENSCAN_predicted_peptide_2|209_aa
MAYTPSYLYKEEGFQLVVVLKKYPMSSLERIPVLLYHFQVHPKDFYQVSDAEKAFDKIQH
PFMIKTLSKIDIQGTYLNIIKVIYDKPTANITLNGEKLKPCHLRNGKRQECTLLPLLFNI
VLEVLARAIRQEKEIKGIQIGKEEVILSLFADDRTIYLENPKDSRKLLELIKEFSKVSRY
KTKIHKSVVACVPTATMQRIKPRTQPLFQ

>SEMA3C_1|GENSCAN_predicted_peptide_3|686_aa
MGTGECGHWHLNSKCGKELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGSKDHILSL
NINNISQEALSVFWPASTIKVEECKMAGKDPPHGCGNFVRVIQTFNRTHLYVCGSGAFSP
VCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAA
IFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQ
IHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPETHFDELGASFKTRLVALL
ANDPTSKPKSVGRSLPIVSLYFSCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPI
HKRPLIVRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELIL
EELEVFKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCSRFYPTGKR
RSRRQDVRHGNPLTQCRGFNLKGIKTYRNAAEIVQYGVKNNTTFLECAPKSPQASIKWLL
QKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFKVLDSE
MVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGDESQKM
RGDYGKLKALINSRKSRNRRNQLPES