GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:17:18

Sequence PMPCB_1 : 17507 bp : 38.74% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1209   1307   99  2  0   98   88   209 0.899  20.21
ccccaattcatttggtaaagaccgctcagcatcatggtcgggccctgattgctttcacaa
ccgcttcgaggagtgtcattcccatcacggccacaaggtggagcccacctccctgctctg
ggacctcaggtcgcgaccccggaagcacatccttcatcctctaccttccttctagcagaa
ATGGCGGCTGCGGCGGCTCGAGTGGTGTTGTCATCCGCGGCGCGGCGGCGGCTCTGGGGT
TTCAGCGAGAGTCTTCTAATCCGAGGCGCTGCGGGACGG
gtgagcttccctccaggccggtcctgtcctcgagatctcgccagacccggcgcagcgcac
ctgagagtcggcgccacagatccgaacagtgggtcgggcagggcctcctcgacccggacc
cgccgggcgccaggcggcctggggctgctgaactggccgggggtgactggcttgtggcca

 1.02 Intr +   2317   2457  141  0  0   50   98    60 0.863   2.83
cagtggctggtgacagatgtttctaggccaggcagagatctcagtggaaccaaaattcaa
gaagaaagattcttttatagagacagcctatttaaaatagatttggttttaaaagcaaca
tttaatatcagattagtaatgtgttttgctttgtctcttccacttcctacccccaaccag
TCATTATATTTTGGAGAGAACAGATTAAGAAGTACACAGGCTGCTACCCAAGTTGTTCTG
AATGTTCCTGAAACAAGAGTAACATGTTTAGAAAGTGGACTCAGAGTAGCTTCGGAAGAC
TCTGGGCTCTCAACATGCACA
gtaagtgactcaggcaaccttctctaagtgacccttcatttagcgtagcaaattgttgat
tttaatctttagctttttcgttggctggtggttcaaaaagggtgacagttattttgcctt
gacagatttccatgagttgtgaaccttttcttccagtggtacttagttacagggtgcata

 1.03 Intr +   3927   4056  130  2  1   73   69   130 0.994   8.95
tcagcttctcaaagtgctggggttacaggtgtgagccatcgtaccatacctgatgtactt
tagaaaccaaatttgaccctgcatgaaactaacttatgtcctccatattcattatctgaa
gtagaatagatgaagtataaagggagtttgcataatttgtttttcctcttttatttcaag
GGCACCAAGAAGAGATCCCAGTTAGATCTGGAACTTGAGATTGAAAATATGGGTGCTCAT
CTCAATGCCTATACCTCCAGAGAGCAGACTGTATACTATGCCAAAGCATTCTCTAAAGAC
TTGCCAAGAG
gtactgttattatttatacagcagataatgtaattttcatgagaatcaggaattatttag
tactatttttattatgtctgttgtaaaagagtaagttccagaaatgtgaaaaagcgaaac
tgaattctgggtgagggtacagctgatcttattttttttctaaatatgacaaatagtaaa

 1.04 Intr +   7591   7789  199  2  1   42   58   156 0.895   5.49
ggggtttatatgttaaattttaattttgtcctgttaagtatatctgatgtttttctccta
ggctaatcatttagtattgagtgatgggtcagtgtcatgatttctgattttggtttaata
gattttaatagtgaaagttaagattgctggcacgttttcttatattttattttcaattag
CTGTAGAAATTCTTGCTGATATAATACAAAACAGCACATTGGGAGAAGCAGAGATTGAAC
GTGAGCGTGGAGTAATCCTTAGAGAGATGCAGGAAGTTGAAACCAATTTACAAGAAGTTG
TTTTTGATTATCTTCATGCCACAGCTTATCAAAATACTGCACTTGGACGGACAATTTTGG
GACCAACTGAAAATATCAA
gtaggtataacagaatttcttggtgtataagggaatttatgaatgttgaaaataaacatt
tacaaattttcaaaaagtatgtttcagaaagtaattttccccctggtaatctaagtgaaa
ctgtagttagctacattttagtcccacctagctcccaagcacgtgagttcataggtactt

 1.05 Intr +   8160   8239   80  0  2   89   88    46 0.907   2.98
ccagtaatggtgtattttttctttgatgtaaaaaaggtgaagttctttgatgtgttgcct
gtatcctatttctgactgcattttaggatacagttatggtccaatttgatttcaggtata
ttatgtgaagatctgttttttttttggtttcctttaaaaattgttttacttcatttacag
ATCTATAAGTCGTAAGGACTTAGTGGATTATATAACCACACATTATAAGGGGCCAAGAAT
AGTGCTTGCTGCTGCTGGAG
gttagtcaatttaaatttctacaaatgttttaaacacagttgttggagtggtatgcttat
tagtttgatcctgttgggagataccctaagaattttcatttacatagcaaataactgata
gtgtgtaaggggaatgtggagcactggaatcagaatttccctctattttttttaaagtag

 1.06 Intr +  11345  11457  113  0  2   72   75    34 0.894  -0.32
tgcaacctcaagctttgcaacaccaaggaaataggtgtgctatgtgagcttactcttaaa
taatggcttttagtgagtgtagatagttcatgtgtaatgtacatcacattataccaccta
gggtttattgtaaactatattgctgctagatacatgtgaaaatattttctttcaatttag
GTGTTTCCCATGATGAATTGCTTGACTTAGCAAAGTTTCATTTCGGTGACTCTTTATGCA
CACACAAAGGAGAAATACCAGCTCTGCCTCCCTGCAAATTCACAGGAAGTGAG
gtagggcaagccttccagctagtatttagccttttggattccttgtgttgtatttacaca
taagtaaacaaaatgtgcatatttccagtaggaaaagaatggaataataggaaaagggaa
gaggatgtactcatttgcttacattccttcctcttccgtattctttaaccacctattttt

 1.07 Intr +  12701  12844  144  1  0   55  115    88 0.896   7.76
cttaattcttctagattaaactcaacaatgtaatgaggcctgatagttaaaaaatcaaaa
tagagtcctggtgtgcattttaactttgcagttaatgggactggtgattttttccttgtt
aataagcatgttatataatgttaatcttaactagaggtcctcctgctttatcttaactag
ATTCGTGTGAGGGATGACAAGATGCCTTTGGCGCACCTTGCAATAGCTGTTGAAGCTGTT
GGTTGGGCACATCCAGATACAATCTGTCTCATGGTTGCAAACACGCTGATTGGCAACTGG
GATCGCTCTTTTGGGGGAGGAATG
gtaagtgattttaaaagaaattttccataacagatggaagattatcatgttttcttaaat
ataagttctttgtaagaatccttttttaaagtggcagaatagagtcttgtactgtgaatt
ctgacttaaaaatataaactgatcctggattgcatgtgggccagaaaaagtttctttttt

 1.08 Intr +  14064  14224  161  2  2  109   81     9 0.432   0.16
taagtgagataataaacacaattcttagtcatactgaattttaactctactactgagatg
ttgaataaaactaggaaacagcctctaaggatattcactattttccacacactccatttt
tctttctgtattttggacatgtataattaaaattctcttggaatttttttttccttgcag
AATTTATCTAGCAAGCTGGCCCAGCTCACTTGTCATGGCAATCTTTGCCATAGCTTTCAG
TCTTTCAACACTTCCTACACAGATACAGGATTATGGGGACTGTATATGGTTTGTGAATCA
TCCACTGTTGCAGACATGCTACATGTTGTTCAAAAAGAATG
gtgagaaaaatagctttaagtaatttaaattttgcctttaattcgttttaaactagtttt
ttatttatactttatggtgatttatggtaattttaccttttaattaagagacctagataa
acagtagttgccatgttttcaaaggttgcagttggtttttcctaagtctcaagatgtgaa

 1.09 Intr +  15392  15477   86  2  2   84   53    34 0.337  -1.96
tatgtatcatttttgagaaattaatactggggaaaataatcattttagcttttgcttagc
attggaattaaattgtaatcacctgtatgttttgtgtagaagatggcatcatcattctta
ggtcattaactcatgaaatacaacattttccaactactactgtttttccacgttttttag
GATGCGACTCTGTACAAGTGTCACAGAAAGTGAGGTTGCACGAGCCAGAAATCTTCTGAA
AACAAACATGTTGTTGCAGCTTGATG
gtaaaaataaagatataggttctgttttcatatggttgatctgtattccaatagttaatt
tttccttctctttaaacaggttcaactccaatttgtgaagatattggtaggcaaatgtta
tgctataatagaaggattcccatccctgagcttgaagcaagaattgatgtaagtagtcct

 1.10 Intr +  15557  15645   89  0  2   95   95    25 0.429   2.67
ttccacgttttttaggatgcgactctgtacaagtgtcacagaaagtgaggttgcacgagc
cagaaatcttctgaaaacaaacatgttgttgcagcttgatggtaaaaataaagatatagg
ttctgttttcatatggttgatctgtattccaatagttaatttttccttctctttaaacag
GTTCAACTCCAATTTGTGAAGATATTGGTAGGCAAATGTTATGCTATAATAGAAGGATTC
CCATCCCTGAGCTTGAAGCAAGAATTGAT
gtaagtagtcctgagttactattgggtcatgtgtaaaaagatccttgttacaaaagctga
gaatatgtatctttcatcttgctttagttttaaaaagttccaggtatagactttgttttt
actacaaacagctgaatgacagtgtcttccatatttcaggctgtgaatgctgagacaatt

 1.11 Intr +  15805  15880   76  0  1   67   99    50 0.361   2.17
gagcttgaagcaagaattgatgtaagtagtcctgagttactattgggtcatgtgtaaaaa
gatccttgttacaaaagctgagaatatgtatctttcatcttgctttagttttaaaaagtt
ccaggtatagactttgtttttactacaaacagctgaatgacagtgtcttccatatttcag
GCTGTGAATGCTGAGACAATTCGAGAAGTATGTACCAAATACATTTATAATAGGAGTCCA
GCTATTGCTGCTGTTG
gtaagcctggcttcttttcttctatgcaaaaagttggccaagtacttttaattaactctt
ctttttaatccttaggtcccattaagcaactaccagattttaaacagatacgcagtaaca
tgtgttggcttcgtgattaaaatgctcctaatcaagattgtttgaacacatgtatttata

 1.12 Term +  15956  16020   65  0  2  116   38    11 0.359  -4.03
gctgaatgacagtgtcttccatatttcaggctgtgaatgctgagacaattcgagaagtat
gtaccaaatacatttataataggagtccagctattgctgctgttggtaagcctggcttct
tttcttctatgcaaaaagttggccaagtacttttaattaactcttctttttaatccttag
GTCCCATTAAGCAACTACCAGATTTTAAACAGATACGCAGTAACATGTGTTGGCTTCGTG
ATTAA
aatgctcctaatcaagattgtttgaacacatgtatttataaaacagagctagagaaaaat
aaaaatgaacatgtatatacatttggaaatttgaattaaatactgtatcatactttcaaa
ggataaaaagactacccctctgaaggttgttttgtattaatggtcagtctttgttctctg

 2.03 PlyA -  16290  16285    6                               1.05
 2.02 Term -  16392  16318   75  0  0  108   48    90 0.856   3.86
 2.01 Intr -  16850  16696  155  0  2   44    3   156 0.651   1.57

Predicted peptide sequence(s):


>PMPCB_1|GENSCAN_predicted_peptide_1|460_aa
MAAAAARVVLSSAARRRLWGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRV
TCLESGLRVASEDSGLSTCTGTKKRSQLDLELEIENMGAHLNAYTSREQTVYYAKAFSKD
LPRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGR
TILGPTENIKSISRKDLVDYITTHYKGPRIVLAAAGGVSHDELLDLAKFHFGDSLCTHKG
EIPALPPCKFTGSEIRVRDDKMPLAHLAIAVEAVGWAHPDTICLMVANTLIGNWDRSFGG
GMNLSSKLAQLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCESSTVADMLHVVQKEWMRLC
TSVTESEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAET
IREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLRD

>PMPCB_1|GENSCAN_predicted_peptide_2|76_aa
XPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELVEMVKA
KKAAQEQVLNASRAKK