GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:00:35

Sequence NPTX2_1 : 14971 bp : 55.09% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    493   1929 1437  0  0   90   29  1092 0.524  94.09
actgttggaccacgtggctccatcatgatgactccagttagatgtcaccccgcccctgag
ctcaggtcttgctgaataaggtcaccgcccagggggcagtcgatgaacacgcgcgcgagg
gctctgcgagtggcctcgtgactttgtccctaactccgggtgtcccctccttcccatcag
CGTCCGGCGCCTGGTCCTGGTCCCGGTCCCCGAGGCCCCCGGGATTCTTCCCGAGCGTTT
TCCGAGTTGGCGCGGGGGGTGGAGGCGGGGCCATGGAGCGCGTCCCGGGGACCGTTGCAT
CCGGAGGCGGCCGTCGTGCGGCTCCTTCCCGCCTCGAGAGTGAGGTGGCCGGGCCTTGAC
GAGAAGGCCCACGCCTGCCGCGGGGGTGGCTCGCGATGGCAGTCGGGGTTCGAGTCCCGC
CTGGGGGGCTGCTCCTGCTGGAGAAAACGCCTCCCTGAGGGCGGCGGCAAACGCGCAGCG
AGGCCCCGTGCCGCGCCAGAAGCCACCCTGAGAAAGGGGCACCGGGACACCGAGGGGTTC
CCACTTTCTCCTCAGCCTGTGACGCCCGCGTCCTCGGGTGGGTTCGAGGGGCGCCTGGGC
ACGGCCAGCCGAGGCTCTCGAGAGCCCCAGTGTCGTTTTCCACCTCAGGCCTCCTTTCCT
GAGGCAGAGCCCGGGACCTCGCGCTCTCGCCTCAGGCTCCGGCCCACGCTCCCGCCCGGC
CGCCAGGCGCGCAACGGAAAGCGCCCCCGCCCCGCCCCGCTCCGCCCACTGCGTGACGCG
CACCCGGCCGAGCCAATCAGAGCTCGTGGCGCGCGCCCCACACGCCGGCCCCCTCCGCCC
CTCAGCTTAAGAAAGGGCGCGCGGACCCGGCAGGCCAGAGTGCCGAGCAGCGCGGTGGGT
GCGGCTGTGAGACGGCAGGAGACTTCTGCCCCGCGGTGCACGCGACCCTCGAGACGACAG
CGCGGCTACTGCCAGCAGCGAAGGCGCCTCCCGCGGAGCGCCCCGACGGCGCCCGCTCGC
CCATGCCGAGCTGAGCGCGGCAGCGGCGGCGGGATGCTGGCGCTGCTGGCCGCCAGCGTG
GCGCTCGCCGTGGCCGCTGGGGCCCAGGACAGCCCGGCGCCCGGTAGCCGCTTCGTGTGC
ACGGCACTGCCCCCAGAGGCGGTGCACGCCGGCTGCCCGCTGCCCGCGATGCCCATGCAG
GGCGGCGCGCAGAGTCCCGAGGAGGAGCTGAGGGCCGCGGTGCTGCAGCTGCGCGAGACC
GTCGTGCAGCAGAAGGAGACGCTGGGCGCGCAGCGCGAGGCCATCCGCGAGCTCACGGGC
AAGCTAGCGCGCTGCGAGGGGCTGGCGGGCGGCAAGGCGCGCGGCGCGGGGGCCACGGGC
AAGGACACTATGGGCGACCTGCCGCGGGACCCCGGCCACGTCGTGGAGCAGCTCAGCCGC
TCGCTGCAGACCCTCAAGGACCGCCTGGAGAGCCTCGAGGTAGCGGCCCGCGGGGAGCGC
GGGGGACCTGGAATGGGGACGCTCCCGAGTCGGGGGCGGAAGACTCGGGAGGATGGGGAA
AGGGGGCCTGGCCCTGGGGAGGGTGTGATCGTCCGTGGGGGTGAGCTGGACTTGAGG
gtgaaaggcggggatctagatcctgctcgggaactcccctgcgtggtatcccttcccaca
ccgctgctcttgctggaaggaaacgtttaaattccacccccgcgcgtcgggactgccagc
gggatccgccgagcacttcccgaggtccgggctagcgaacccagacggccaagccgcggg

 1.02 Intr +   3547   3763  217  0  1   24   85   441 0.839  36.00
actttgaaatcttttccataccaaaaaagcatcagtgagatgctcccctgcctgccagtg
gcaagattcagggcttgcgttttggaagcttctccctgtgtggtcgggccatcacagcca
catttcacaatttctttttaactctttctgtgcccctccctcctccccggtggctgaaag
CACCAGCTCAGAGCAAACGTGTCCAATGCTGGGCTGCCCGGCGACTTCCGCGAGGTGCTC
CAGCAGCGGCTGGGGGAGCTGGAGAGGCAGCTTCTGCGCAAGGTGGCAGAGCTGGAGGAC
GAGAAGTCCCTGCTGCACAATGAGACCTCGGCTCACCGGCAGAAGACCGAGAGCACCCTG
AACGCGCTGCTGCAGAGGGTCACCGAGCTGGAGCGAG
gtgtgtgcctggcctgtttctctgtctggcagtggcctgattttcaccacttgtggtcag
acatgcgattctggttgatggacagcagggattgtgacaccacatgggcctggttcccga
gtgtgtgagcaaataataaaggcgactgaacaaggtcatctcaggaatgagctgccagcc

 1.03 Intr +   5034   5065   32  1  2   87  121   -17 0.465  -0.17
catgccaggcgggagctcagactcctggtatgcccgtttcatagatgagaaaaagactcc
gttctcagtgggacatgtatcttttggggagggggcccaaagtgggtcctgggccactag
ctggcaaacagtgacagtcacatcaacctgcacctcctccttctctttctctcactcaag
GCCAATGTCATTTCACTGGGCTTACTCCTAAG
gtaagccatcatcatggctttggccacccagaagctgccactttgtgactgtccctttca
tccccagcctgtccattaccagccagaaagaaacagtcaggactcagaccccgccagcct
gactcctgaccctttagtttcccagcaagccctcaaagctcatctggcacagaggggaag

 1.04 Intr +   6273   6405  133  2  1   58   65    55 0.456   0.92
cacctgcagtgtctgatttattggtcaggccttttaattccttaattggttttaaccaag
tttcctccaaaccgccaagctgttttatttaaataaaagacactggctctcagggtacag
gccccctcctctgcccctcggctcttccagctctaattaaacctatctgttgtcaccaag
CTAACAATATTACCCACACGGAGTCGTATCAGATTGGCAAGGCTGCCCTCCCGCAAGTAT
AGCAGCCATTTCTCTTTATTAGACAATGATGCCTTCATTAAGGACATGGTCATTTGCCAC
TTGAAGATTAAGT
gtgagtggctaagtgtcgtggaaagagggacttccggcccctggcctgtcattcactagc
tgtgtgaccttggatacgtcacctcacttcgctgagcctccgagcctcaactgtgcaacc
tgcaaaaatgggggagtagggacactctggttctctctctcagttttgcttttcagccta

 1.05 Intr +   8826   9070  245  1  2   73  100   511 0.997  48.55
ccagacttcagccttttatcagtggctggtgtggagcggtctttggtcgcttgctggagg
gtccatcaaggctgtgtgagggaccttcttgtgggtctagcaagatgtggctctgggccg
tgctggtgggtggtggggtggcctaacgcactcctggcctctcttcctcccaacccccag
GCAATAGCGCCTTTAAGTCACCAGATGCGTTCAAGGTGTCCCTCCCACTCCGCACAAACT
ACCTATACGGCAAGATCAAGAAGACGCTGCCTGAGCTGTACGCCTTCACCATCTGCCTGT
GGCTGCGGTCCAGCGCCTCACCAGGCATTGGCACCCCCTTCTCCTATGCGGTGCCAGGGC
AGGCCAACGAGATCGTGCTGATCGAGTGGGGCAACAACCCCATCGAGCTGCTCATCAACG
ACAAG
gtgaggcccgcctgcaccgccaccctccccagaacccatcatgtggtggagggagccaca
gcccccaccccagccgtcctcgccctcctcgggccacacagcagtgtcccagacatggga
ctgcggggctgtcctcctcgaggtggggatagctttgcacacgccgggcggctcacaggg

 1.06 Intr +  11069  11248  180  1  0   76   94   222 0.907  22.18
tgctctggggtcagggtttccaccaaggctgcccccttgcatgttctccacgcatgaccc
cggtgacaggaggagcagtgtggcccagggggactgtggggtgtccttcctgcttcctgc
cctgggggaccctgagggcgtgggcccagcaggtccttacctgcacattgctgctcacag
GTTGCGCAGCTGCCCCTGTTTGTCAGTGACGGCAAGTGGCACCACATCTGTGTCACCTGG
ACGACACGGGATGGCATGTGGGAGGCATTCCAGGACGGAGAGAAGCTGGGCACTGGGGAG
AACCTGGCCCCCTGGCACCCCATCAAGCCCGGGGGCGTGCTGATCCTTGGACAAGAGCAG

gtgggtgcagggcaggtgcaggtgggcacagggtgggtgcaggatgggcacagggtggcc
gtgcgccctttcagggatggtgcgaggaggggccaactgagcagcacgaggccaggcctg
cagctgttcctgctcccggccccagctgttggcccctcagacctggccacagtgtcctga

 1.07 Term +  12306  12533  228  2  0  112   42   282 0.979  22.96
atttgagcgatgccacctcccagttctgacatgcctgggagcttcagaacctacagaaac
aggtagtgttggtcagagctggggggcatcagagaaatgcccaaatctcctgtctgcagc
ccgtgtgcagggggacttgtgaaccagccctgacgcagctctcttgttcccattccccag
GACACCGTGGGGGGTAGGTTTGATGCCACTCAGGCATTTGTCGGGGAGCTCAGCCAGTTC
AACATATGGGACCGCGTCCTTCGCGCACAAGAAATTGTCAACATCGCCAACTGCTCCACA
AACATGCCGGGCAACATCATCCCGTGGGTGGACAATAACGTCGATGTGTTCGGAGGGGCC
TCCAAGTGGCCCGTGGAGACGTGTGAGGAGCGTCTCCTTGACTTGTAG
ccgccttctcctctgtccaggaggccgggatcaggctgttgccatggaagttcagggcca
tagactgccccacttaaactcttgtcagtctgggctcagggttcccagagctcattcccc
aggaatctctaagaccagggctggggcagtgtctgtcactggcttgtttgttccctacca

 2.02 PlyA -  13583  13578    6                               1.05
 2.01 Term -  13896  13722  175  2  1   88   39   137 0.937   6.35

Predicted peptide sequence(s):


>NPTX2_1|GENSCAN_predicted_peptide_1|823_aa
RPAPGPGPGPRGPRDSSRAFSELARGVEAGPWSASRGPLHPEAAVVRLLPASRVRWPGLD
EKAHACRGGGSRWQSGFESRLGGCSCWRKRLPEGGGKRAARPRAAPEATLRKGHRDTEGF
PLSPQPVTPASSGGFEGRLGTASRGSREPQCRFPPQASFPEAEPGTSRSRLRLRPTLPPG
RQARNGKRPRPAPLRPLRDAHPAEPIRARGARPTRRPPPPLSLRKGARTRQARVPSSAVG
AAVRRQETSAPRCTRPSRRQRGYCQQRRRLPRSAPTAPARPCRAERGSGGGMLALLAASV
ALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRET
VVQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSR
SLQTLKDRLESLEVAARGERGGPGMGTLPSRGRKTREDGERGPGPGEGVIVRGGELDLRH
QLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLN
ALLQRVTELERGQCHFTGLTPKLTILPTRSRIRLARLPSRKYSSHFSLLDNDAFIKDMVI
CHLKIKCNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPF
SYAVPGQANEIVLIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQD
GEKLGTGENLAPWHPIKPGGVLILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEI
VNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLLDL

>NPTX2_1|GENSCAN_predicted_peptide_2|58_aa
XAPKPTRSRLRQTRDIILLPEVAKPYPFPPSAPEHEEDKHRSIFQCTLIEIPSSEEFS