GENSCAN 1.0	Date run: 16-Jan-104	Time: 21:00:36

Sequence NEUROD6_1 : 5858 bp : 41.36% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   2856   3869 1014  2  0   55   39   648 0.956  53.36
ttcacaaactcaaaattatatttaatgttaaaaaatcaggcccagaatcagtctttttca
cgtgtttttgtaatcttatgattaaataattaaatatgttttaagtgtataaactttaaa
aatgaaaaccctttaaatattgtgctggcattttttcaggtaatttaagattagagaacc
ATGTTAACACTACCGTTTGATGAGTCTGTTGTAATGCCAGAATCCCAGATGTGCAGAAAG
TTTTCTAGAGAATGCGAGGACCAGAAGCAAATTAAGAAGCCAGAAAGCTTTTCCAAACAG
ATTGTCCTTCGAGGAAAGAGCATCAAAAGGGCCCCTGGAGAAGAAACCGAGAAAGAAGAA
GAGGAGGAAGACAGGGAAGAGGAAGATGAAAATGGGTTGCCTAGAAGGAGGGGTCTTAGG
AAAAAAAAGACAACAAAGCTGCGATTGGAAAGGGTCAAGTTCAGGAGACAGGAAGCGAAC
GCGCGCGAGAGGAACAGGATGCACGGCCTCAACGACGCTCTGGACAACTTAAGAAAAGTG
GTCCCCTGTTATTCTAAAACCCAGAAACTGTCCAAAATAGAGACTTTACGACTGGCCAAA
AACTACATCTGGGCACTTTCTGAAATTCTGAGAATCGGCAAGAGACCAGATCTGCTCACA
TTCGTCCAAAACTTATGCAAAGGTCTTTCCCAGCCAACTACAAACTTGGTGGCAGGCTGC
TTGCAGCTCAACGCCAGGAGTTTCCTGATGGGTCAGGGTGGGGAGGCTGCACACCACACA
AGGTCACCCTACTCTACCTTCTACCCACCCTACCACAGCCCTGAGCTCACCACTCCCCCA
GGGCATGGGACTCTTGATAATTCCAAGTCCATGAAACCCTACAATTATTGCAGTGCGTAT
GAATCCTTCTATGAAAGTACTTCCCCTGAGTGTGCCAGCCCTCAGTTTGAAGGTCCCTTA
AGTCCTCCCCCAATTAACTATAATGGGATATTTTCCCTGAAGCAAGAAGAAACCTTGGAC
TATGGTAAAAATTACAATTACGGCATGCATTACTGTGCAGTGCCACCCAGGGGTCCCCTT
GGGCAGGGTGCCATGTTCAGGTTGCCCACCGACAGCCACTTCCCTTACGACTTACATCTG
CGCAGCCAATCTCTCACAATGCAAGATGAATTAAATGCAGTTTTTCATAATTAA
tgaggaaaatgaaaataaacagtggtcattcacctcccctgtctaattaagacaaagcag
atgcttgtgggctgagtaattggcacaactctatctaaggtgtttactagtttctgaagt
gtgtttcaactattgtgagaattttctatgtaataataaatctcttttcgtatgagaact

 2.02 PlyA -   4410   4405    6                               1.05
 2.01 Term -   5499   5183  317  1  2   79   54   165 0.922   6.32

Predicted peptide sequence(s):


>NEUROD6_1|GENSCAN_predicted_peptide_1|337_aa
MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEE
EEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKV
VPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGC
LQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAY
ESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPL
GQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN

>NEUROD6_1|GENSCAN_predicted_peptide_2|105_aa
XQVSVGAAARVRRAQSPGPQGAHCGRDTGSAACARAATEATQRRQQPLPAPPARPRRACA
GSGGAHKVPEGQRWPGLPKTCPVPPPLHPLSAALIGLRSCPRSSP