GENSCAN 1.0	Date run: 16-Jan-104	Time: 23:07:22

Sequence HTR5A_1 : 16005 bp : 43.16% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1941  741  0  0   80   90  1083 0.932 102.44
accatctccaacggatgctcactagcaggaaattggggccaaattcacaggcactttcca
gaaactcccccactggccagaggttgcaaacatccggattggctctgggcacagtggccg
ccttaagtcctcctgaacaccccttctgcaagtaccccagggcggtctcctgacccagag
ATGGATTTACCTGTGAACCTAACCTCCTTTTCCCTCTCCACCCCCTCCCCTTTGGAGACC
AACCACAGCCTCGGCAAAGACGACCTGCGCCCCAGCTCGCCCCTGCTCTCGGTCTTCGGA
GTGCTTATTCTCACCTTGCTGGGCTTTCTGGTGGCGGCGACGTTCGCCTGGAACCTGCTG
GTGCTGGCGACCATCCTCCGTGTACGCACCTTCCACCGCGTGCCCCACAACCTGGTGGCA
TCCATGGCCGTCTCGGATGTCCTGGTGGCCGCGCTGGTCATGCCGCTGAGCCTGGTGCAC
GAGCTGTCCGGGCGCCGCTGGCAGCTAGGTCGGAGGCTGTGCCAGCTTTGGATCGCGTGC
GACGTGCTTTGCTGCACGGCCAGCATCTGGAACGTGACGGCCATAGCCCTGGACCGCTAC
TGGTCCATCACGCGCCACATGGAATACACGCTCCGCACCCGCAAGTGCGTCTCCAACGTC
ATGATCGCGCTCACCTGGGCACTCTCCGCTGTCATCTCTCTGGCCCCGCTGCTTTTTGGC
TGGGGAGAGACGTACTCTGAGGGCAGCGAGGAGTGCCAGGTAAGCCGCGAGCCTTCCTAC
GCCGTGTTCTCCACCGTAGGCGCCTTCTACCTGCCGCTCTGTGTGGTGCTCTTCGTGTAC
TGGAAGATCTACAAGGCTGCCAAGTTCCGCGTGGGCTCCAGGAAGACCAATAGCGTCTCA
CCCATATCCGAAGCTGTGGAG
gtgggtatctcagcaatccttaaaaatactcgacttgcatctgtacaggctatatcccca
ggccacctgccccacccccacacttgtagaaaatggaactttttgtgtttgggagtgggg
ggagtaaactgggagagtggaagaaagcatcagagatgtactttgctctgacatgttccc

 1.02 Intr +  11514  11557   44  2  2   79  116   -21 0.109  -3.16
ggtttaaacaagaaaaacgtctgcttgttatcagttatagaacaatcagtcttgtcctaa
gtttgtggagggttttgattcataccctcgtggaggcttccttgatgtgtaaggccattt
ttagcttaaacatttttattgttccattgagctcctgtgacccatctctcattctgacag
TGGTGTGGTCTAACTTGCAAATCACCTGAAACCACACTTCCAAG
gtaagagtctataccttaacttcaatacccattattgaaggtaatccattgactatctag
gacattattagacaggcaaagcagagtggttggatgaaataaaagagcataccagatttg
tgattaaccagtaaataattatttagcatgcaatcattttggaaggatgaaagctctaac

 1.03 Intr +  12328  12853  526  1  1  -25   18   725 0.193  47.15
cccaggggtaccattttaaatcagtgtcactctttcttctgtcaagtgagttggcattga
atgcagcaccaaagatggcccagtaaaataatcaacatttcacaaggtaatagaaaaata
tgcttttctgaacaacgtggagttctatgactaaactctaaaaaaattctaagccctaag
TGTCATTGATATCACCAGTGTGATCATCACCACTGTGAACAGTATCTTCAGTGTGACCAG
CATCTCCAGTATAATCAGCATCCGTGGTGTCTCCAGTGGGACCAGCATCCCCATTGTGAA
CAGCATCTCCAGCGTGACCAGCATCCACAGTGTGAACGACATCCACACTGTGAACAGCAT
CCATGGTGTCACCAGCGTGACCAGCATCCACAGTGTGAATGGCATCCATGGGGTCACCAA
TGTGACCAGCATCCACAGTGTGAACAGCATCCATGGTGTTACCAGTGTTACCAGCATCCA
CAGTGTGAATGGCATCCATGGTGTCATCAGGGTGACCAGCATTCACAGTGTGAACAGAAT
CTTCAGCGTGACCAGCATCTCCAGTGTGACCAGCATCCCCAGTGTGAACAGCATCTCTAG
TATGATCAGAATCCATGGTGTTTCCAGTATAACCAGCATCTCCAGTGTTACCAGCATCCT
TTATGTGACCAGTGTGATAAGCCTCCACAGTGTGACCATGTCTCAA
gtatgaccagtgttaccagtgtccccattgtcactcataaaaatgtgccaaggggaagga
gactttccagagggttgaagagtccagctagaattcttgttttattgccgtcttgggaca
atatggaaaacagcttccctgatattattagggggttgaattctgttaaggaaactggta

 1.04 Term +  14474  14806  333  1  0  127   55   478 0.717  43.01
gctctgttgcctggtttccatatctgagagcgagtgccacaggccttcaggttcccacac
ctatccatcgaagactttcccttgagtggatgtgcggaatccaggcctgtcagtgtccag
gctcagcctagcaggtagactgaggtggctcctcataaagctcctgcttgtcttttacag
GTGAAGGACTCTGCCAAACAGCCCCAGATGGTGTTCACGGTCCGCCACGCCACCGTCACC
TTCCAGCCAGAAGGGGACACGTGGCGGGAGCAGAAGGAGCAGCGGGCCGCCCTCATGGTG
GGCATCCTCATTGGCGTGTTCGTGCTCTGCTGGATCCCCTTCTTTCTCACCGAGCTCATC
AGTCCCCTCTGCTCCTGTGACATCCCCGCCATCTGGAAAAGCATCTTCCTGTGGCTTGGC
TACTCCAACTCCTTCTTTAACCCCCTGATCTATACGGCTTTCAACAAGAACTACAACAGC
GCCTTCAAGAACTTCTTTTCTAGGCAACACTGA
gggagaggaccaggattgaaaaaagtttcttcccataattcagtggaattcccagttcat
ccatttcccatccccacccaacagccatgtggacgggatgaatcctcaccattctccagg
gtcatcttcagaactgcactggccgcttttccacctcctcagtaggaatatgactcctca

Predicted peptide sequence(s):


>HTR5A_1|GENSCAN_predicted_peptide_1|547_aa
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEWCGLTCKSPETTLPSVIDITSVIITTVNSIFSVTSISSIISIRGVSSGTSIPI
VNSISSVTSIHSVNDIHTVNSIHGVTSVTSIHSVNGIHGVTNVTSIHSVNSIHGVTSVTS
IHSVNGIHGVIRVTSIHSVNRIFSVTSISSVTSIPSVNSISSMIRIHGVSSITSISSVTS
ILYVTSVISLHSVTMSQVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGIL
IGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK
NFFSRQH