GENSCAN 1.0	Date run: 16-Jan-104	Time: 20:56:03

Sequence HOXA3_1 : 23232 bp : 49.48% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   3747   3787   41  2  2   92   92    48 0.093   2.62
gcctcactaggaatgaatctctcagaagtgagattccaacttaccatttgatttttaaaa
acacacaccctcagatttatctccaaaggcttttaactccttcaggaaggcaggagagag
ccctcggcagggaggacggagctggcaggccctcaccagatcttggggccttttccgcag
GGTTTCTGCGAGTCCAGGGAGCGCGCCGCGTCCGGGGAAAC
gtgagttcgggcttgggttttctgcggtcacatcctggctttggtgatgaagtgggacgg
atgcgcagacagttggtaatgttctgattcacgctggggaaggctgcagagataccacag
gacgggcgcgcggctttgttcaattttcccggcgttcataaatcacccgcgccgggcgag

 1.02 Intr +   5579   5662   84  2  0  108   87    67 0.070   7.54
tagactggaacatttcgagcaatgagtgcgccacacggacgagtgccctggtgactccct
gatgttcgcgtcacccccagggccaccttggcgcccgcatgagcctcgcttcccactccc
ggcctccaactcccttccctcgcagccgccattcaccttctgctgtttatttgtctgcag
AGCGCCTGGACACCGGAAAAGGCGATTCCCTGAGCGCCTGGAGTTGGAGACAATTCCTGG
TTCAGAATTTAAACATCTTTCTAG
gtaagcgctgctccaaaactcttcgccgcgtgggactttgcaccagggcggttgggagga
gttggccctccacggttcctggcaaccgcggcctgttgaaagaggttctggtcaatattt
aacttcggaggagtttggagttggattcctttaagcttcttgccctgcgagtgcggggcc

 1.03 Term +  10197  10212   16  0  1  140   48   -11 0.019  -2.19
tgggcgagctagccgatggaagtcgaggctataccaggaggatggaatttattttaaggt
atttccgccgattgttcatatctagagtgagttatggctgtgagagacaaaggtcaggcg
aggagaccctggctcatggacaggaccctcagcctctctcttcctttgtttctcttttag
AACCGAAACCATTTGA
aagattcccagtagcgcctcagactctgaatttaattccctggaaagtgttgggggtgta
aaggagggggcactaggggggctcctaggtgggcccagtggcccccagtgcaagggtggc
tttgtccactgcagcagggcagggctggagtctcaggagctgatccccaggcggaaagag

 2.01 Init +  17583  18108  526  2  1   59  103   495 0.996  43.12
attgagagtaagatggatttgcgcggagccctcaccgcgctgcgcttctcgccccaccag
gtctgcgcggggcggccattggcggcggagtgtcacgtgaccgcgggggcgtgccaatgt
gcgccctcacgggtgtcaaacccctgtcagagtgtgcgatcaagatcgtgaaacaacgcg
ATGCAAAAAGCGACCTACTACGACAGCTCGGCGATCTACGGTGGCTACCCCTACCAGGCA
GCCAACGGGTTCGCTTATAATGCCAATCAGCAGCCGTACCCGGCGTCCGCCGCTTTGGGC
GCCGACGGCGAGTACCACCGACCCGCCTGCTCCCTCCAGTCTCCCTCCAGCGCCGGGGGC
CACCCCAAGGCACACGAACTGAGTGAGGCGTGCCTGCGCACCCTGAGCGCCCCACCTAGC
CAGCCTCCAAGCCTGGGAGAGCCGCCCCTGCACCCGCCGCCGCCCCAGGCCGCGCCCCCT
GCCCCACAGCCGCCTCAGCCCGCACCTCAGCCCCCTGCACCTACCCCTGCCGCGCCCCCG
CCTCCCTCTTCTGCCTCCCCTCCTCAGAATGCCAGCAACAACCCTACCCCTGCCAACGCG
GCCAAGAGCCCCCTGCTCAACTCACCCACAGTGGCCAAACAAATCTTCCCCTGGATGAAA
GAGTCTCGACAAAACACAAAGCAGAAAACCAGCAGCTCCAGCTCAG
gtaaaggagtgccttctggaagagggtcctctggcctggctcctggtccccaagctactg
cccacgacatccagcacagcctaggagcgatggagcatgtctggaattcactgctcccac
accactgcccaccaaaaaggttttcatagtctttgcaacttagggaggtgataggcctct

 2.02 Term +  19503  20308  806  1  2  148   44   950 0.999  89.99
agggagtatcactgttttacccaccaggagagaggatagcacctagttcctacttctctc
tgggacctgacggatgcaggaacctttggggcctggtggaaggaggggccgggctgggtc
aggggctgggcggggccgcggcagcccctgacgccgctcttcctctctctgtcctcgcag
GCGAAAGCTGCGCTGGCGACAAGAGCCCGCCGGGGCAGGCTTCGTCCAAGCGCGCGCGCA
CGGCCTACACGAGCGCGCAGCTGGTGGAGCTGGAGAAAGAGTTCCACTTCAACCGCTACC
TGTGCCGGCCGCGCCGGGTGGAGATGGCCAATCTGCTGAACCTCACTGAGCGCCAGATCA
AGATCTGGTTCCAGAATCGCCGCATGAAGTACAAAAAGGATCAGAAGGGCAAGGGCATGC
TAACGTCATCGGGGGGCCAGTCTCCAAGTCGCAGCCCCGTGCCCCCCGGAGCCGGTGGCT
ATCTGAACTCTATGCATTCGCTGGTCAACAGCGTCCCGTATGAGCCCCAGTCGCCCCCGC
CCTTCTCCAAGCCCCCCCAGGGTACCTACGGGCTGCCCCCCGCCTCCTACCCTGCGTCCC
TGCCCAGCTGCGCACCCCCGCCACCCCCACAGAAGCGCTACACGGCGGCAGGGGCGGGCG
CAGGGGGCACCCCCGACTATGACCCGCACGCTCATGGCCTGCAGGGCAACGGCAGCTATG
GGACCCCACACATACAGGGAAGCCCCGTCTTCGTGGGGGGCAGCTATGTGGAGCCCATGA
GCAACTCCGGGCCAGCCCTCTTTGGTCTAACTCACCTCCCCCACGCTGCCTCGGGCGCCA
TGGACTATGGGGGTGCCGGGCCGCTGGGCAGCGGCCACCACCACGGGCCGGGGCCTGGGG
AGCCGCACCCCACCTACACGGACCTTACCGGCCACCATCCTTCTCAGGGAAGAATTCAGG
AAGCACCCAAGCTCACCCACCTGTGA
tagtgggcttggggctacgcgccaggagagtctccccccacccaccttttttctttggtt
gcttttttttttttttttttttaggttcttcctgccctttccttccttccttttctctct
tctccgccccgcactccgtttcccggtttcccccctcgttggtaaggcgtttttatagtt

 3.03 PlyA -  21205  21200    6                               1.05
 3.02 Term -  21451  21222  230  2  2   56   41   179 0.374   6.79
 3.01 Init -  23012  22997   16  2  1   86   99     1 0.382   1.46

Predicted peptide sequence(s):


>HOXA3_1|GENSCAN_predicted_peptide_1|46_aa
GFCESRERAASGETAPGHRKRRFPERLELETIPGSEFKHLSRTETI

>HOXA3_1|GENSCAN_predicted_peptide_2|443_aa
MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGG
HPKAHELSEACLRTLSAPPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPP
PPSSASPPQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCA
GDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQ
NRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQSPPPFSKP
PQGTYGLPPASYPASLPSCAPPPPPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHI
QGSPVFVGGSYVEPMSNSGPALFGLTHLPHAASGAMDYGGAGPLGSGHHHGPGPGEPHPT
YTDLTGHHPSQGRIQEAPKLTHL

>HOXA3_1|GENSCAN_predicted_peptide_3|81_aa
MNVLTAAGNRAAQLARRTALPELPQPPGAPAAILRIRRASRRIAWPGPMLEPEGCCVRPA
LPARLGLNSTQTHVFGQRTPS