GENSCAN 1.0	Date run: 16-Jan-104	Time: 20:56:31

Sequence HOXA13_1 : 5596 bp : 51.05% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   2122  922  0  1   51   56  1444 0.932 131.78
cgctttgcatacgccgtgggcggagcgggggggccgggccaatgggcggccgcctggcgc
gaccccgcggggcgcgatccgcccccctcgctcgggccccggccccgcgccgcgcgctct
tcacttcttgggggctttttaaaacagcgccactggggtcttctccatgcggctcgggct
ATGACAGCCTCCGTGCTCCTCCACCCCCGCTGGATCGAGCCCACCGTCATGTTTCTCTAC
GACAACGGCGGCGGCCTGGTGGCCGACGAGCTCAACAAGAACATGGAAGGGGCGGCGGCG
GCTGCAGCAGCGGCTGCAGCGGCGGCGGCTGCCGGGGCCGGGGGCGGGGGCTTCCCCCAC
CCGGCGGCTGCGGCGGCAGGGGGCAACTTCTCGGTGGCGGCGGCGGCCGCGGCTGCGGCG
GCGGCCGCGGCCAACCAGTGCCGCAACCTGATGGCGCACCCGGCGCCCTTGGCGCCAGGA
GCCGCGTCCGCCTACAGCAGCGCCCCCGGGGAGGCGCCCCCGTCGGCTGCCGCCGCTGCT
GCCGCGGCTGCCGCTGCAGCCGCCGCCGCCGCCGCCGCGTCGTCCTCGGGAGGTCCCGGC
CCGGCGGGCCCGGCGGGCGCAGAGGCCGCCAAGCAATGCAGCCCCTGCTCGGCAGCGGCG
CAGAGCTCGTCGGGGCCCGCGGCGCTGCCCTATGGCTACTTCGGCAGCGGCTACTACCCG
TGCGCCCGCATGGGCCCGCACCCCAACGCCATCAAGTCGTGCGCGCAGCCCGCCTCGGCC
GCCGCCGCCGCCGCCTTCGCGGACAAGTACATGGATACCGCCGGCCCAGCTGCCGAGGAG
TTCAGCTCCCGCGCTAAGGAGTTCGCCTTCTACCACCAGGGCTACGCAGCCGGGCCTTAC
CACCACCATCAGCCCATGCCTGGCTACCTGGATATGCCAGTGGTGCCGGGCCTCGGGGGC
CCCGGCGAGTCGCGCCACGAACCCTTGGGTCTTCCCATGGAAAGCTACCAGCCCTGGGCG
CTGCCCAACGGCTGGAACGGCCAAATGTACTGCCCCAAAGAGCAGGCGCAGCCTCCCCAC
CTCTGGAAGTCCACTCTGCCCG
gtaaatgacgacctattcccagccctggtcttccggctctgctccagcttcttctccgct
cgcacccgggcgatcccgggtgcctttctgttctcttcctggtctgccctagcggctctg
cacccctgggagcccgagcatggctggctgggtctgcctgcactgcctcgagttgagctg

 1.02 Term +   2836   3080  245  2  2  126   39   181 0.895  13.39
tcagttcagaactaactaccttccccactgaccctctaggctttagcagaagacaggatt
gtacagcgggtggcaaagagcagccgggcgctgcaaggcgggtggctcagatcgagctgt
cgcctatgccctggctggggtccgatccctgtgtaacttgccttctcccttgtcttctag
ACGTGGTCTCCCATCCCTCGGATGCCAGCTCCTATAGGAGGGGGAGAAAGAAGCGCGTGC
CTTATACCAAGGTGCAATTAAAAGAACTTGAACGGGAATACGCCACGAATAAATTCATTA
CTAAGGACAAACGGAGGCGGATATCAGCCACGACGAATCTCTCTGAGCGGCAGGTCACAA
TCTGGTTCCAGAACAGGAGGGTTAAAGAGAAAAAAGTCATCAACAAACTGAAAACCACTA
GTTAA
tggattaaaaatagagcaagaaggcaacttgaagaaacgcttcagaactcgttgctttgc
ccagataatgataataatgcttaataataattgaagaatgggaaagagaaagagacagag
actggcattttcctctcccgaaggagatctctttctctttaatggaatctacaactgttt

Predicted peptide sequence(s):


>HOXA13_1|GENSCAN_predicted_peptide_1|388_aa
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPH
PAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAA
AAAAAAAAAAAAASSSGGPGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYP
CARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPY
HHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPH
LWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTN
LSERQVTIWFQNRRVKEKKVINKLKTTS