GENSCAN 1.0	Date run: 16-Jan-104	Time: 21:26:08

Sequence GUSB_1 : 23921 bp : 51.98% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1227   1436  210  2  0   98   64   466 0.999  41.97
caagccctaccgggcagcgcccggccccgcccctccaggcctggcactcgtcctcaacca
agatggcgcggatggcttcaggcgcatcacgacaccggcgcgtcacgcgacccgccctac
gggcacctcccgcgcttttcttagcgccgcagacggtggccgagcgggggaccgggaagc
ATGGCCCGGGGGTCGGCGGTTGCCTGGGCGGCGCTCGGGCCGTTGTTGTGGGGCTGCGCG
CTGGGGCTGCAGGGCGGGATGCTGTACCCCCAGGAGAGCCCGTCGCGGGAGTGCAAGGAG
CTGGACGGCCTCTGGAGCTTCCGCGCCGACTTCTCTGACAACCGACGCCGGGGCTTCGAG
GAGCAGTGGTACCGGCGGCCGCTGTGGGAG
gtgcgatctcggggcagggccgggaggcgcccgaaagcccggcggtgggagtaggggagc
ccgggccccccgcagacttcttcccctgggcgtctccgagctggggcccgcaggaggtta
aaggtcaacgggcttgggggcgccggcttgggggacgggggaacaggagcaccctggagg

 1.02 Intr +   3001   3186  186  0  0   93   49   260 0.980  23.00
gcccaggtgcacagatcgccctggcagttgacctgtcatcagcaagttatctgtcctttc
tgccaagaatccccgctatgtgtcagggcttgtgctaggcctgggggcacagccgtgcag
cacactggtcctggacccttttgggggcctaggagctgagcccggctcttctctccacag
TCAGGCCCCACCGTGGACATGCCAGTTCCCTCCAGCTTCAATGACATCAGCCAGGACTGG
CGTCTGCGGCATTTTGTCGGCTGGGTGTGGTACGAACGGGAGGTGATCCTGCCGGAGCGA
TGGACCCAGGACCTGCGCACAAGAGTGGTGCTGAGGATTGGCAGTGCCCATTCCTATGCC
ATCGTG
gtcagtgcggccaggagcaggcagggcgggtgggggggcacggctgctgaacagcatggg
acctccagctgccacccacggcatgtatgctggggtgggatggtggggggtcctgccctg
ccctgccctgggggctgtgccctgtatagggggataggtagcctgatctaccccattggg

 1.03 Intr +   3499   3683  185  0  2   96   39   256 0.917  20.60
ggctgtgccctgtatagggggataggtagcctgatctaccccattgggatgtcattcttc
ccgtctggctggaaggccccggagccccatgctgcaggttatgtgagggagtgcccgata
gtagggcgcctcctcatgccctgacctgcagccccctccccgtatctcctgtgtctgcag
TGGGTGAATGGGGTCGACACGCTAGAGCATGAGGGGGGCTACCTCCCCTTCGAGGCCGAC
ATCAGCAACCTGGTCCAGGTGGGGCCCCTGCCCTCCCGGCTCCGAATCACTATCGCCATC
AACAACACACTCACCCCCACCACCCTGCCACCAGGGACCATCCAATACCTGACTGACACC
TCCAA
gtgggtaccatcctgcctccattgcacacacccaccttcccgccccaccctgtggtcttc
ctggtagggactgggtggccttcacagagtggaggccttggatctggggaggccagggag
gcctgtgagctgaggtcaggggacccagagcaagggcccagcaaaccacagtcctcccat

 1.04 Intr +   3869   4011  143  2  2   49   65   263 0.923  20.61
taccatcctgcctccattgcacacacccaccttcccgccccaccctgtggtcttcctggt
agggactgggtggccttcacagagtggaggccttggatctggggaggccagggaggcctg
tgagctgaggtcaggggacccagagcaagggcccagcaaaccacagtcctcccatcctag
GTATCCCAAGGGTTACTTTGTCCAGAACACATATTTTGACTTTTTCAACTACGCTGGACT
GCAGCGGTCTGTACTTCTGTACACGACACCCACCACCTACATCGATGACATCACCGTCAC
CACCAGCGTGGAGCAAGACAGTG
gtgagggcttctggtaggatcctctcagcggggcccagggtggctctgtttgttccctgt
ttggaaagctctcccaggaaaaaggtgctcccagcatctctacaccctcacagattccct
tccacctatgaagctaaaattcagcctgtgtgagcggatacgggctcccaaaatcacccg

 1.05 Intr +   7208   7395  188  0  2  147   80   157 0.976  20.73
ctgcactccagcctgggggacagagtgagactccgtctcaaaaaaaaaaaataagaaatt
aaatttaaaaaaagcaacagaaacaaatggctgcctggcagcggtggctgcagggcgctc
ctgtttgtgtgactcaggtcgtgtccctccctcagccctggtctctcttgtttcttgcag
GGCTGGTGAATTACCAGATCTCTGTCAAGGGCAGTAACCTGTTCAAGTTGGAAGTGCGTC
TTTTGGATGCAGAAAACAAAGTCGTGGCGAATGGGACTGGGACCCAGGGCCAACTTAAGG
TGCCAGGTGTCAGCCTCTGGTGGCCGTACCTGATGCACGAACGCCCTGCCTATCTGTATT
CATTGGAG
gtaatggtggtttgggacatgcctaagggaggtcttttgcccccatgtggtgaccctggc
ttcagcaggagcccaagacaggtggatgggcaggcatggtcctctgagctttctgatgtt
tctcacccttggtgggaggcccattttcttttttttttttttttttgagatggtctcact

 1.06 Intr +   8339   8491  153  1  0   89   33   226 0.992  17.98
tgttttgaagggcaggttcccagggtcagccagggtagggcagaacctctgattgctgca
tctctgcttacaggcccagaggcagctgctggggtgcacgaggggccttcctgctggagg
gcaggccggatggggctcaggctgtcggggtgctcacacctggtgctttggctgtcatag
GTGCAGCTGACTGCACAGACGTCACTGGGGCCTGTGTCTGACTTCTACACACTCCCTGTG
GGGATCCGCACTGTGGCTGTCACCAAGAGCCAGTTCCTCATCAATGGGAAACCTTTCTAT
TTCCACGGTGTCAACAAGCATGAGGATGCGGAC
gtgtgttggggctcctgggtccttgtcggggctgcttctggtcaccctccactttcgcct
tccctgtgtcctgcagttgagggcagctcagggcaatgaggcaaatggctccaaatggag
agggggctcatggggtggctctccagggtcctggctctcagaggaagtgcagcttcgaca

 1.07 Intr +   8706   8884  179  2  2   95   78   395 0.999  38.43
cttctggtcaccctccactttcgccttccctgtgtcctgcagttgagggcagctcagggc
aatgaggcaaatggctccaaatggagagggggctcatggggtggctctccagggtcctgg
ctctcagaggaagtgcagcttcgacagggacaggggtcacttggctctgctatctcctag
ATCCGAGGGAAGGGCTTCGACTGGCCGCTGCTGGTGAAGGACTTCAACCTGCTTCGCTGG
CTTGGTGCCAACGCTTTCCGTACCAGCCACTACCCCTATGCAGAGGAAGTGATGCAGATG
TGTGACCGCTATGGGATTGTGGTCATCGATGAGTGTCCCGGCGTGGGCCTGGCGCTGCC
gtgagtctctgctgtgcacctgctccgcctgcccagcccgggggcgtcaccgtgaccctc
tgtcccttccctcctggcccgcaggcagttcttcaacaacgtttctctgcatcaccacat
gcaggtgatggaagaagtggtgcgtagggacaagaaccaccccgcggtcgtgatgtggtc

 1.08 Intr +   8969   9115  147  2  0  116   81   131 0.968  15.06
cagccactacccctatgcagaggaagtgatgcagatgtgtgaccgctatgggattgtggt
catcgatgagtgtcccggcgtgggcctggcgctgccgtgagtctctgctgtgcacctgct
ccgcctgcccagcccgggggcgtcaccgtgaccctctgtcccttccctcctggcccgcag
GCAGTTCTTCAACAACGTTTCTCTGCATCACCACATGCAGGTGATGGAAGAAGTGGTGCG
TAGGGACAAGAACCACCCCGCGGTCGTGATGTGGTCTGTGGCCAACGAGCCTGCGTCCCA
CCTAGAATCTGCTGGCTACTACTTGAA
gtgagtgctccctccctgccctcggctagagtgggaaggagaccctggcaggtggctggc
ctcggtgggcatgtgctgttcaagatcggcctcgtgtccagcccaatgggaaggccgtcc
atacccagatagttcaggggaccaaatatctacccacccaaattgtggttttcttttttg

 1.09 Intr +  13044  13128   85  0  1   92   72    52 0.951   4.32
ctcctgacctcaagtgatccacccacctcggcctcccaaagtgctgggattacaggtgtg
aaccatcgtgcctggccccgtgttgtgttctggcggtggaagatgggacagagaggatgg
gagggtgtctgagccattcctggactgatggaacctgtttcttctgccttttgtggacag
GATGGTGATCGCTCACACCAAATCCTTGGACCCCTCCCGGCCTGTGACCTTTGTGAGCAA
CTCTAACTATGCAGCAGACAAGGGG
gtgagcctgggggtccccaccccacttctccctgcctttgcctgggcttgtcctgaagcc
tggtcatgggaacagccaggaagaaccatgcgctgccagtctgggttttatttcattttc
ttttttacttaaaaagatagagacagggtcttgccatgttgcccaggctggtctccaact

 1.10 Intr +  15503  15679  177  1  0   75  115   214 0.998  23.43
taatgctgcagtcttgctgtgttgcccaggctggtcttaagccatcctcctgcctcagcc
tcccagagtgctgggattacatcccccttaccttctctgccagaggagcccccgcagtgt
gtgaatgctgagtcatgctgtctactgagtgctgaacgggctctgctgctctggtcctag
GCTCCGTATGTGGATGTGATCTGTTTGAACAGCTACTACTCTTGGTATCACGACTACGGG
CACCTGGAGTTGATTCAGCTGCAGCTGGCCACCCAGTTTGAGAACTGGTATAAGAAGTAT
CAGAAGCCCATTATTCAGAGCGAGTATGGAGCAGAAACGATTGCAGGGTTTCACCAG
gtaagcagtgttgagctttctgcttgtgtgttctctcagggcagagatgtcactcacctc
ctccagcctgacctgcgcccactgcactgctcccctcgcttcagctttgggctctcctcc
cacggccccgtccacgttccctcaccgccaacagccaggcctgtgccccactcacttggt

 1.11 Intr +  18952  19087  136  0  1   71   84   144 0.959  12.95
tttattctgggttacatcattccctggctgtctttaccccagcatcagtgagtcctgcag
tcactatagccccctgtgaagacagatattttggtcaccatcaagtggatctttattttt
atctaacatttacaattctgccagttctgactcttacattctctttgccttgaatcctag
GATCCACCTCTGATGTTCACTGAAGAGTACCAGAAAAGTCTGCTAGAGCAGTACCATCTG
GGTCTGGATCAAAAACGCAGAAAATACGTGGTTGGAGAGCTCATTTGGAATTTTGCCGAT
TTCATGACTGAACAGT
gtaagtggcagtttggctcatgggataacgtacccgtcctcattttttcaggttgccttt
ccaattctggccatttcaattgtaagaatattggaaacaaagttggggaagctggtttaa
tccatgtaggttgcgttgagaattttctaggaaaagtaagttgtgtttaggaagtaggaa

 1.12 Intr +  22347  22458  112  1  1   94   68    62 0.199   4.74
ccaggaggttgaggctgcagtgagctatgattgtgtcaccgcattccagcctgggcaaca
gggagaaaaaagaaaaaaaaagacatttctatttagtgcctaccttagctccagactggt
tctaacttgacccatcagaagacatctgaatcgctttgtgtcttttttttttttttgtag
CACCGACGAGAGTGCTGGGGAATAAAAAGGGGATCTTCACTCGGCAGAGACAACCAAAAA
GTGCAGCGTTCCTTTTGCGAGAGAGATACTGGAAGATTGCCAATGAAACCAG
gtatccccactcagtagccaagtcacaatgtttggaaaacagcctgtttacttgagcaag
actgataccacctgcgtgtcccttcctccccgagtcagggcgacttccacagcagcagaa
caagtgcctcctggactgttcacggcagaccagaacgtttctggcctgggttttgtggtc

 1.13 Term +  22765  22858   94  1  1   91   41    48 0.146  -2.00
cctcctggactgttcacggcagaccagaacgtttctggcctgggttttgtggtcatctat
tctagcagggaacactaaaggtggaaataaaagattttctattatggaaataaagagttg
gcatgaaagtggctactgaaaagcatctgaaatcatttctgtgcgtcgtgctgttttcag
AGCTTTAACTGTGTGTGGACTTTTGAGAAACTGCTGCTCCAACACCCCCACCACGTTCAG
AGCAGCTGGTTCCCGAGGGCGTCTGCAGGAATAG
ccccatggtcctagggccaccgtgtttgtgtagcaaaccaggccagcctcgacagggagt
gagtagaagactttcacagctgctgttcgactcctcagatgagctaaagtcccacatgta
ccaacaaattcatagaaacgctgtcattgttgcagcacttaacagggtctgtgtgccagt

Predicted peptide sequence(s):


>GUSB_1|GENSCAN_predicted_peptide_1|664_aa
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFE
EQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV
LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT
LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD
SGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL
YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKG
FDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN
VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVT
FVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSE
YGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRALTVCGLLRNCCSNTPTTFRAAGSRG
RLQE