GENSCAN 1.0	Date run: 16-Jan-104	Time: 20:31:10

Sequence GPR146_1 : 4156 bp : 61.07% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    596    685   90  1  0   60   41    80 0.299   1.09
ggaacgatgccgtctgctcgtctgcctgagacgctttctactccactccgagagtaggag
gtcagccggggccaaatgacatggtggacatcaggcttcccgagatagctgtaggtccct
gaggaatgcctgtgctttggcggggtgggggggtgggggtggcgaaattcttactctagg
ATGGCTCCAGCCGCCAGGTTCTCATTCAGTGACGTCAAGACTGGCTATGTCCCCATGTCC
CCAGAGCCTCCTGTGGGCTGCGACCCACAG
gtcaccctccctggagcccaggctctgcaaggactccaaggcaccgggtcctgagctgcc
gggagggagggagggaggctcagggctgaccgtccacattgcctgtccctcccggcgctg
gcaagatgcgaacaccacagccatctagtaaacttcgggaatcactgtgcggggcccgtc

 1.02 Term +   1188   2213 1026  2  0  134   48  1752 0.906 169.32
cccgagacggccatttttcaacgctcaacttcactttcacagaaatgcaccaaaggcagc
ctcgctctgtggtctgcagcgattactgcaccaggagaaggcacccctgtacctgcagca
cttctgggccagggctttgggacgggacgcgagctgaccacctgttccttctttccgcag
GGTCGCGGAGCCTCGCCGGCCGCCATGTGGAGCTGCAGCTGGTTCAACGGCACAGGGCTG
GTGGAGGAGCTGCCTGCCTGCCAGGACCTGCAGCTGGGGCTGTCACTGTTGTCGCTGCTG
GGCCTGGTGGTGGGCGTGCCAGTGGGCCTGTGCTACAACGCCCTGCTGGTGCTGGCCAAC
CTACACAGCAAGGCCAGCATGACCATGCCGGACGTGTACTTTGTCAACATGGCAGTGGCA
GGCCTGGTGCTCAGCGCCCTGGCCCCTGTGCACCTGCTCGGCCCCCCGAGCTCCCGGTGG
GCGCTGTGGAGTGTGGGCGGCGAAGTCCACGTGGCACTGCAGATCCCCTTCAATGTGTCC
TCACTGGTGGCCATGTACTCCACCGCCCTGCTGAGCCTCGACCACTACATCGAGCGTGCA
CTGCCGCGGACCTACATGGCCAGCGTGTACAACACGCGGCACGTGTGCGGCTTCGTGTGG
GGTGGCGCGCTGCTGACCAGCTTCTCCTCGCTGCTCTTCTACATCTGCAGCCATGTGTCC
ACCCGCGCGCTAGAGTGCGCCAAGATGCAGAACGCAGAAGCTGCCGACGCCACGCTGGTG
TTCATCGGCTACGTGGTGCCAGCACTGGCCACCCTCTACGCGCTGGTGCTACTCTCCCGC
GTCCGCAGGGAGGACACGCCCCTGGACCGGGACACGGGCCGGCTGGAGCCCTCGGCACAC
AGGCTGCTGGTGGCCACCGTGTGCACGCAGTTTGGGCTCTGGACGCCACACTATCTGATC
CTGCTGGGGCACACGGTCATCATCTCGCGAGGGAAGCCCGTGGACGCACACTACCTGGGG
CTACTGCACTTTGTGAAGGATTTCTCCAAACTCCTGGCCTTCTCCAGCAGCTTTGTGACA
CCACTTCTCTACCGCTACATGAACCAGAGCTTCCCCAGCAAGCTCCAACGGCTGATGAAA
AAGCTGCCCTGCGGGGACCGGCACTGCTCCCCGGACCACATGGGGGTGCAGCAGGTGCTG
GCGTAG
gcggcccagccctcctggggagacgtgactctggtggacgcagagcacttagttaccctg
gacgctccccacatccttccagaaggagacgagctgctggaagagaagcaggaggggtgt
ttttcttgaagtttcctttttcccacaaatgccactcttgggccaaggctgtggtccccg

Predicted peptide sequence(s):


>GPR146_1|GENSCAN_predicted_peptide_1|371_aa
MAPAARFSFSDVKTGYVPMSPEPPVGCDPQGRGASPAAMWSCSWFNGTGLVEELPACQDL
QLGLSLLSLLGLVVGVPVGLCYNALLVLANLHSKASMTMPDVYFVNMAVAGLVLSALAPV
HLLGPPSSRWALWSVGGEVHVALQIPFNVSSLVAMYSTALLSLDHYIERALPRTYMASVY
NTRHVCGFVWGGALLTSFSSLLFYICSHVSTRALECAKMQNAEAADATLVFIGYVVPALA
TLYALVLLSRVRREDTPLDRDTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISR
GKPVDAHYLGLLHFVKDFSKLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCS
PDHMGVQQVLA