GENSCAN 1.0	Date run: 16-Jan-104	Time: 20:33:58

Sequence GNA12_1 : 115354 bp : 45.92% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1544  344  0  2   85   80   792 0.881  72.81
ggcccgagtggcggccgggcgacgagtgcgggcctcggagcgactgcagcggcggcggcg
gacgcggcctgaggcgagcggcggggcgtggggcggtgcctcggcccgggctcgccctcg
ccggcgggagcgtccatggcccccgggcgccggcggggcgcggccgcggcctgaggggcc
ATGTCCGGGGTGGTGCGGACCCTCAGCCGCTGCCTGCTGCCGGCCGAGGCCGGCGGGGCC
CGCGAGCGCAGGGCGGGCAGCGGCGCGCGCGACGCGGAGCGCGAGGCCCGGAGGCGTAGC
CGCGACATCGACGCGCTGCTGGCCCGCGAGCGGCGCGCGGTCCGGCGCCTGGTGAAGATC
CTGCTGCTGGGCGCGGGCGAGAGCGGCAAGTCCACGTTCCTCAAGCAGATGCGCATCATC
CACGGCCGCGAGTTCGACCAGAAGGCGCTGCTGGAGTTCCGCGACACCATCTTCGACAAC
ATCCTCAAGGTGACGCGCGCCCCCCGCCCAGCACCTGCACCCAG
gtgggccggggcgctaacccccgccccgggcccctccgtggtccgccgccgcgggcgggg
acccctggggcgaggatgctggatccagccccgcctgcaccccactcccccccgacccat
tccccgaggcctgctggcgtcgtctctgccccaccccgtctcgccctttttgagatgggg

 1.02 Term +   2019   2112   94  0  1  106   43    15 0.428  -3.90
aggcgcgcaccaccagcccagctaatttttaagtttttttttgtagagatggggtcttgc
tgtgttgcccaggctggtctcagtctcctggcctcaagtgatcctcctgccttggtctcc
ctcaagtgctgggattataggcatgagtcatggcgcccggtctgcctctgccctctctag
GGTGCCTGGGGACCGTGGGAGTGGGAACTCGGGCCAGCTTCTGGGGATGGGGAGTGGGGG
CTTGGCACTTAGCCCCCTCCTGGATGTGCCCTAG
cagaatggtatctgtccatttcccactggaagatttgtgggataggagcccaaccggccg
tgccctccggctgagcttagaagaagagcagtggagactggacgggaaccagccatgagt
ctctttttacttttctgtttttttagaaaggctctcactctcttgcccaggctggtctca

 2.02 PlyA -   3934   3929    6                               1.05
 2.01 Sngl -   9744   9409  336  0  0   90   53   298 0.249  22.53
 2.00 Prom -  11642  11603   40                              -3.76

 3.08 PlyA -  16654  16649    6                               1.05
 3.07 Term -  19691  19471  221  0  2   35   43   177 0.943   5.10
 3.06 Intr -  20080  20010   71  0  2   69   41    79 0.146   0.13
 3.05 Intr -  23684  23661   24  1  0  101   87    30 0.030   1.34
 3.04 Intr -  26460  26360  101  0  2   69   76    15 0.023  -2.69
 3.03 Intr -  29361  29213  149  1  2  -22  115   124 0.628   4.05
 3.02 Intr -  30339  30171  169  0  1   50   74   173 0.560  11.62
 3.01 Init -  31211  31185   27  2  0   69   94     7 0.264  -0.96
 3.00 Prom -  32470  32431   40                              -4.76

 4.01 Init +  36859  37023  165  0  0   65   57    99 0.048   4.14
ggaagtagggaaattgtagctgtctctggaaggtagaaccacggcattggctgacaggct
gggccagacctcaggatggtgcatctcccctagctgcaggccgctgctgctctgtgggga
gtgaggtcctcctgtgcggcccaggtccctctccatcccatccaaattcaggcccacagg
ATGGTCCAGGGTAACCCACAGCACCTGGGCACTCTCCTACTACAGCCAGTGGCCAGCCTG
CAGGGACAGACAGCCTCCAAGGCCACAGTCAGCTCGGCCCACACCCTTGCTGATCTGCAG
AAGGTGCAGAAGCAGCTTTTCAGGCAGCATGGTAGCAGGGCCTGG
gtaggccagctctggcttaacccaagtgcaggccgtaagcactgaaggcgctgctctagg
tgggtgtcgggtagcactactcatgatggtcactgcttacaggagggagttgggtatgcg
tgagaaggaaacatgttcacagattcccgaaagagatattgaaacttgcagaggccaact

 4.02 Term +  48820  48954  135  0  0   57   48   199 0.703  10.82
gaaacaagcaaaagaatgaaaagtagtttctcatcacaaacgatggtgacgttaaatcta
gaacatgatcccctggctcccgttttggtgggcgggctacttggcttgtcgtattttagt
cttttcctgtctcatgactgctgactgcctggatttgtatgttttcccacccgttttaag
CTGGAAGAAGCAGTTGTATCTTTTGGAATAGAGGAGCTGCCAGATTTCAGTGATGATGAC
AATAGTAGCGCTGGTAGTACTCTTGGCAGTACAGTCATCTCCCGTTATCCACAGCCAGCC
GCCAACGGAAAATAG
gcgcggacagtgataccacatttgagagacagaaggagagaccatatttacttaactttc
atgacagtatattgttataattgttgtattttattattagctattattaatctcttactg
tgcctaattcataaattaaattaaactttaaaaacaatacaggtagggcttggtaccgtt

 5.01 Init +  49998  50099  102  2  0   66   70     4 0.914  -3.36
tcagctgagactacaggtgtgccaccaccaagcccagctgtttttaatttgatttaattt
tttgtagaagcagggtcttgctctgttgcccaggccggtctcagactcctgtgttccagc
agtcctccctctttggcctcccaaaggggaggctcacagtgtgagccactgctctcggcc
ATGTGCGTCTGTCTTGGTGAGGTTATACTGCTGAGAGTTAAGACTTTCCACATCACAACA
AACAAACCAAGAGACAGACTCAGGCTGCACAGCTCAGAGCTT
gtgagttttctgcgttatgacaatggatgcccattttgagcttctctagcgtggtttagt
ctttggaatgcaattaaatcctctcttctttcttttattttctagggctcaagggttctt
gttgatgcacgagataagcttggcattccttggcagtattctgaaaatgagaagcatggg

 5.02 Intr +  50205  50420  216  2  0  136  105   226 0.993  27.80
ctgctgagagttaagactttccacatcacaacaaacaaaccaagagacagactcaggctg
cacagctcagagcttgtgagttttctgcgttatgacaatggatgcccattttgagcttct
ctagcgtggtttagtctttggaatgcaattaaatcctctcttctttcttttattttctag
GGCTCAAGGGTTCTTGTTGATGCACGAGATAAGCTTGGCATTCCTTGGCAGTATTCTGAA
AATGAGAAGCATGGGATGTTCCTGATGGCCTTCGAGAACAAGGCGGGGCTGCCTGTGGAG
CCGGCCACCTTCCAGCTGTACGTCCCGGCCCTGAGCGCACTCTGGAGGGATTCTGGCATC
AGGGAGGCTTTCAGCCGGAGAAGCGAGTTTCAGCTG
gtgagtgagtaggccttcttgctgggcacctgatagtgtgttttttacatgactattttg
gaccgttagttgaatttccttaaaaactgtgtaacagtccaagcaagctctaaatcaccg
taagttgtaatgatcaacaaccaaaacacgggatggaggcagatgctatataaaaggctc

 5.03 Term +  53721  53765   45  2  0  117   54    66 0.973   3.31
tcaaaatacacaattacagcaaaactgaaagaccatacccatctgaagtcaccgttacca
gggctccctcccccacccctgcagtagacccttgtttctcttccaatcttttcctgagtg
tcaaagcttttctagggcaatgcttcatcaccttgttttttgcttgtctttcttccccag
CTGACAGCATTTGACAGTCCCTGTGAAGAGCTGCAGCTGCTTTGA
gaattgctgtcagccaggtactaggcgcctccctgttccctctgccgtcttgctttttcc
tgccattccagtcagagatagaaacaaaaagaggaggaaaaaaggctgtgtctggtgatt
accttgtgacgaccctttctcctctgagaggagcagggtgggccggggtgggggatggaa

 6.04 PlyA -  54347  54342    6                               1.05
 6.03 Term -  57797  57780   18  2  0  110   49    18 0.373  -1.58
 6.02 Intr -  58541  58386  156  2  0   76   74    72 0.885   4.81
 6.01 Init -  59252  59121  132  2  0   90   58   107 0.641   8.05
 6.00 Prom -  59589  59550   40                              -7.06

 7.01 Init +  69401  69466   66  1  0   86   26    77 0.065   0.53
tgaggctgcaatgagcggtctaacctggatgacagggtgaaacccagtctcataaaaaaa
aatcaaaagacccattgttagcccccagggctatacttgccagctgtgtccagggccttc
ccaccaggggagctgccccatagccaccggcagtttctgtctctccagctggcaggcaga
ATGGCTGCATCAAGCCTAGCTGTACGGACCTTTTCCACAGTACGGGTCTGGGCCCTGTGC
CCCTGG
gtaacctgtccaggtagtgtgagggatgaagggaggggaggactctgccagctctgtggg
aggctccttaggtgattctgagcctggcctgtattgagagccactgatgagcctctgagg
tctcttccacttgtgacgtgattcggagcctggccctctgctttaattcataggcagagt

 7.02 Intr +  73611  73709   99  2  0   12   51   127 0.131   1.71
ctctcacacacccctggtagaaatgtgaaatggtactcctgctttggaaaagcggggcac
tttcttaaaagttaaacatacaattatcacatgagctagcccttccacatgtagatattt
accaaagagaagtgaaaatatttgtccacacaaagacttgcacacacatgtttatggcag
CTGAACATTGGGAACGTGGCCATCAACAAGCAGATGGATGAACAGACTGGGGTGCACCCT
TCTGTGGGGATACTGCTCAGCCAGGAAAGGGAGCACCTG
gtaacctgcagcatatgggcgaatctggaaagaattgtgccaagtgcaggaggccacaca
aagaagggagtgtcctctaagatctgacttacatgagaatctagaatatgcagaccaaca
tggagggatagatgccgaccacgggttgcctgggcaggaagggagtgcaggggaggggaa

 7.03 Intr +  82439  82503   65  1  2  101   57    79 0.553   3.62
agggagccccggtctgcgtcctggaggaacggcacgctgagtcctgggccagtggccggc
ggggctgttggcgaccacagtagcacacaagggctctttctgaggagcaggagaccctgg
cacgggccccacgggagtgtctggggcgtccccgcctgtggcctcttctccccgccgcag
CACCAGTGGCTCCACGAGCAGGGCTCGGAGCTGGCCCTCTCCTGCTTCGGAGCCGCGCTG
ACTGG
gtgtgtggcggatgggaggccgccctgagtgctcctcctcccttttgtacagcctgggtg
gaaaggacgggcctggtgcacttcctgcgggagggaggacatggggcctgcttccctctg
gcgctcctccacccgggcagcgtggtttctttccaaatgatttatcctctcatcgtcctg

 7.04 Intr +  82939  83025   87  1  0   71   52    73 0.378   1.09
caggaaatgtcattggatctaactccagaatagaaggcgtggtggaactgcttttgtagt
ccacagttaggctactcacacctcaggccccgcacacgggtgggttcagaggctggactt
tggagttaagtagcgtttttgcccttggccaagttaacgtctaagctttggtttcctcag
TGAGGAAAGTGGGAACCGCCATACCGTGTCTGGATTCGGTGGGATCGTGTGTGTCCAGCA
GCAGTCGCGCAGCGCCTGGCGTGAGTG
gtgggtgcacgccggccccgccatgtgcaccttctgtgacgaccctaagtcagggtggtg
tttcctagcagtgcagaacacgaagcccttacaacttctcctagaaacgaagcctgggtt
gacccctccacctcagggtgagagcttttggtattttgagtcagtatttttggcatgtct

 7.05 Intr +  83620  83731  112  1  1   66   50   100 0.810   4.38
tggaccagctggaagccgaattttacgttgtgacctaaagagctgttaggtactcagcac
tatccagggtatgaaagcagcattagttggtcatctcttcacgttttaatgaacgtgaag
tgccgatgctcttttcattttccagtggcccatcttgtcaactcttcattgttttttaag
CAAATTCAAGGATTCGGTCAAAGGAGAACCAATAGCTGCAAATTGTAAATCCTGTGAAAT
TGTCTTTGGGTTCCGTCCTGAGAGGCCGGTTCGGGAACGTGCCCTGTGTAAA
gtgagaactgtttgtatcctaggaattcggtagatgaggtagtgacaattctggagggcg
atgctgtccgttccagctctttttagtcatcctgaattgcatcaggttttaggaaaaagt
ttctggttttcttctttatttgtactaggcttctgaaatatctcaaattctgccatgaag

 7.06 Term +  91285  91554  270  0  0  -48   32   285 0.302   4.78
ttgagtcactgccaattaagggagatgcagactcagactgctgtgagctagcactacaca
cctattaacacagatacaatagaaaatagtgaaaataacaaatgctggtgaggatactga
gaagctgggtctcattcatcactggtggggaggtaaaagggtacaaccgttctggaaaag
AGTTTGGCAGAGAGTAACGCTGAACTTAAGGGTTTAGATGTAGATTCTCTGGTCACTGAG
CATATCCAAGTGAACAAAGCACCTAAGATGCGCCGCCGGACCTACAGAGCTCGTGGTCGG
ATTAACCCATACATGAGCTCTCCCTGCCACATTGAGATGATCCTTACTGAAAAGGAACAG
ATTGTTCCTAAACCAGAAGAGGAGGTTGCCCAGAAGAAAAAGATATCCCAGAAGAAACTG
AAGAAACAAAAACTTATGGCACAGGAGTAA
attcagcattaaaataaatgtaattaaaaggaaaaaaaaattaaacatacacttatacag
cccggcagtcacactcctgggcatttaccctagagaaatgaaacttacatccacaccaca
cctgtacatgaatgttcacagagttttatgtgtaatagctaaaatacagaaacaaccaaa

 8.03 PlyA -  92830  92825    6                               1.05
 8.02 Term -  95888  95816   73  1  1   71   50    36 0.520  -4.52
 8.01 Init -  97446  96320 1127  0  2   60   53   268 0.409  14.17
 8.00 Prom -  97944  97905   40                              -7.56

 9.02 PlyA -  97956  97951    6                               1.05
 9.01 Sngl -  98899  98174  726  1  0   45   35   316 0.546  18.23
 9.00 Prom -  99359  99320   40                              -5.86

10.02 PlyA -  99528  99523    6                               1.05
10.01 Sngl - 100772 100479  294  2  0   88   54   240 0.986  16.30
10.00 Prom - 104147 104108   40                              -5.36

11.01 Init + 111062 111115   54  1  0   19   33   143 0.662   1.18
tgagaacacagaaagtgactgctcttcccacaagccctgatgtcagggcagcctggaagc
cttgaccccgcctgctggtgtctgtctttagagcagggttcaaagtggaatcttatagaa
agtggtataattggtttttaatacgctacctttgaagggactcattgcgtgcctgttcat
ATGCGGGCTGCTCTGTGGTCGGTGGTTGCGCTCTCCCGGCTCCTCCCGTGCCCC
gtgtgtgcctcgcatttggcggctcagcgcttcctgaaacggggtcctgggtgattccgc
agggcccttcgcactatggaacacgtctcagattgtatcgatgattggtccaggcaggag
aagactggccatcattccaccacaacaatccaaatggaagattcccctgtgtttgctact

11.02 Intr + 111833 111883   51  1  0  114  105   143 0.955  17.70
tttctttaatggtagtttttttattttagaaaacacacggacactctctgcctttttcct
ttgctttcccattcacacggaggcgaaatgccactgctcttaccctgttcagttcttgta
tttgccacatcaggattcctcagtccagactgagctgtgaatattcttccttcctgacag
GGGGAGTCGGTGAAGTACTTCCTGGACAACTTGGACCGGATCGGCCAGCTG
gtgagtaagcacgcccgcccgaagaagctgggctccagggttagaaaacatgtgtccaga
gaccaaagcagtccacgttgtgaggactttggctggactgacaggccgagcttgttctgt
cacattaccacgaatagtactgtaatggcacgctctcacttggatctgggccccgtctca

11.03 Term + 113586 114155  570  2  0  121   53  1262 0.983 120.44
gattctttctgtttcacggccagttgataatgttataaatgaaatttgcttttggtttct
ggttcaacctgttgcaaaagtcagtctctttccttcttatctttttgccatctttttgtt
tctattttctctgttctttcttcctccccctaaatttctgcctcatcctgtattttacag
AATTACTTTCCTAGTAAGCAAGATATCCTGCTGGCTAGGAAAGCCACCAAGGGAATTGTG
GAGCATGACTTCGTTATTAAGAAGATCCCCTTTAAGATGGTGGATGTGGGCGGCCAGCGG
TCCCAGCGCCAGAAGTGGTTCCAGTGCTTCGACGGGATCACGTCCATCCTGTTCATGGTC
TCCTCCAGCGAGTACGACCAGGTCCTCATGGAGGACAGGCGCACCAACCGGCTGGTGGAG
TCCATGAACATCTTCGAGACCATCGTCAACAACAAGCTCTTCTTCAACGTCTCCATCATT
CTCTTCCTCAACAAGATGGACCTCCTGGTGGAGAAGGTGAAGACCGTGAGCATCAAGAAG
CACTTCCCGGACTTCAGGGGCGACCCGCACAGGCTGGAGGACGTCCAGCGCTACCTGGTC
CAGTGCTTCGACAGGAAGAGACGGAACCGCAGCAAGCCACTCTTCCACCACTTCACCACC
GCCATCGACACCGAGAACGTCCGCTTCGTGTTCCATGCTGTGAAAGACACCATCCTGCAG
GAGAACCTGAAGGACATCATGCTGCAGTGA
gcgaggaagccccggggtttgtcgtcgttgagcagcccccacggctgtcggtcagactct
tgggtgtgtgttgtctgtgtggtccttgagtgggtttctcggatccgtgccctggaatac
ctggctcaggaatgctgtcagaccagccagccagcgagctctaggcaaaaggacatggaa

Predicted peptide sequence(s):


>GNA12_1|GENSCAN_predicted_peptide_1|145_aa
MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKVTRAPRPAPAPRVPGDR
GSGNSGQLLGMGSGGLALSPLLDVP

>GNA12_1|GENSCAN_predicted_peptide_2|111_aa
MVATMKKTAAEDVNVTFEEQQKINKFAWNTSRITELKEEIEVKQKQLQNVEDARDGTMLA
DADCLMMPYQIGDVFISHSQEETQEMLEAANKNLQEATDALESKVEAIQWV

>GNA12_1|GENSCAN_predicted_peptide_3|253_aa
MGLLSSQNHSPVKATKRRHCGRLRGHNREPDRQGLARMRLPSSLEKEQYKKQVDRNIGEV
PAVRHSTLRLSTHPGETLAAAHGGVDTDTQCSTVGRRENGKQPEYAFTGNGSAIMKAVRQ
ATSPWHGQNSKDGRGYSSIGNLGERSLQSKTVMNNASSCQDFPLANQKPESTTLAATIYT
GKQPYEKCLRKRVLAFASRTLKEGGCRTEKPGKRLWWGRRHKAAAAAEENKSLEYAHSSV
HPSIPTTQGTTST

>GNA12_1|GENSCAN_predicted_peptide_4|99_aa
MVQGNPQHLGTLLLQPVASLQGQTASKATVSSAHTLADLQKVQKQLFRQHGSRAWLEEAV
VSFGIEELPDFSDDDNSSAGSTLGSTVISRYPQPAANGK

>GNA12_1|GENSCAN_predicted_peptide_5|120_aa
MCVCLGEVILLRVKTFHITTNKPRDRLRLHSSELGSRVLVDARDKLGIPWQYSENEKHGM
FLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLLTAFDSPCEELQLL

>GNA12_1|GENSCAN_predicted_peptide_6|101_aa
MREAMVGDGSVFRLWCYTCNTVTQYYMHTLTNASLLVFIPCYNPMATLGIPNPPCPSRDL
KERWVMAFMGRLGTLGLKHVSWQRAKPPARKTPDATAPTIF

>GNA12_1|GENSCAN_predicted_peptide_7|232_aa
MAASSLAVRTFSTVRVWALCPWLNIGNVAINKQMDEQTGVHPSVGILLSQEREHLHQWLH
EQGSELALSCFGAALTGEESGNRHTVSGFGGIVCVQQQSRSAWRECKFKDSVKGEPIAAN
CKSCEIVFGFRPERPVRERALCKSLAESNAELKGLDVDSLVTEHIQVNKAPKMRRRTYRA
RGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQKLMAQE

>GNA12_1|GENSCAN_predicted_peptide_8|399_aa
MSELPFTIASKRIKYLGIQLTRDVKDLFKENYKPLLKEIKEDTNKWKNIPCSWVGRIDIM
KMAILPKVIYRFNAIPIKLPMTFFTELEKTTLKFIWNQKRACIAKSILSQKNKAGGITLP
DFKLYYKATVTKTAWYWYQNRHIDQWNRTEPSEIMLHIYNYLIFDKPDRNKQWGKDSLFN
KWCWENWLAICRKLKLDPFLTPYTKINSRWIKDLNVRPKTIKTLEENLGNTIQDIGMGKD
FMSKTPKAMATKAKIDKWDLIKLKSFCTAKETTISMNRQPTEWEKIFATYSSDKGLISRI
YNELKQIYKKKTNNPIKKWAKDMNRHFSKKDIYAAKRHMKKCSSSLAIREMQIKTTMRCH
FTPVRMVIIKKSGNNRWELNNDNTWTREGEHHTPGTIVG

>GNA12_1|GENSCAN_predicted_peptide_9|241_aa
MKAEIKMFFETNENKDTTYQNLWDTFKAVCRGKFIALNAHKRKQEKSKIDTLTSQLKELE
KQEQTHSKASRRQEITKIRAELKEIETQKTLQKINESRSWFFEKINKTDRPLARLIKKKR
EKNQIDAIKNDKGDIITNPTEIQTTIREYYQHLYANKLENLEEMDKFLDTYILPRLNQEE
VESLNRPITGSEIEAIINSLPTKKSPGADGFNSRILPEVQGGAGTIPSETIPINRKRGNP
P

>GNA12_1|GENSCAN_predicted_peptide_10|97_aa
MGKKQSRKTGNSKNQSTSPPPKERSSSPATEQSWMDNDFDELRKEGFRQSNYSELQEEVR
TNGKEVKNFEKKLDKWITRITNAEKSLKDLMELKTKA

>GNA12_1|GENSCAN_predicted_peptide_11|224_aa
MRAALWSVVALSRLLPCPGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFV
IKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIF
ETIVNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDR
KRRNRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ