GENSCAN 1.0	Date run: 16-Jan-104	Time: 20:59:44

Sequence GARS_1 : 41862 bp : 38.95% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1558   1779  222  0  0   48   86   245 0.988  16.90
gggtccttccgggttttgtgtcgaatctgcggcggcgacccggcgccgcgtcacgcggtg
gtgaatgtgcggcagcacgcgcgccgcgtcgtttacgcggcgatttcatcatgctccgag
ccgggcggcgcgcgccgcttccgtcgccaccctctctggacagcccagggccgcaggctc
ATGCCCTCTCCGCGTCCAGTGCTGCTTAGAGGTGCTCGCGCCGCTCTGCTGCTGCTGCTG
CCGCCCCGGCTCTTAGCCCGACCCTCGCTCCTGCTCCGCCGGTCCCTCAGCGCGGCCTCC
TGCGCCCCGATCTCCTTGCCCGCCGCCGCCTCCCGGAGCAGCATGGACGGCGCGGGGGCT
GAGGAGGTGCTGGCACCTCTGAGGCTAGCAGTGCGCCAGCAG
gtaccggtgttttgcgctctccgctaagcctccggctctcctcccagggccttcttctgg
tcatccttccctcctccccggggaactgtcctcctcttcggttacccctttctttccctt
catcctctggcgtcttcttcgcctcccccactttggtcccaagtcccccgtgcgtcagcc

 1.02 Intr +   5432   5533  102  1  0   59  113   161 0.999  15.15
tgatctcagatggtgaggagggcctttcaaagtgctggtattacaggcgtgagccaccac
gcttggcctgaattgcatcattcttacatagactttttaaaaggcacgcttaaaaacaca
ttcctaacatttcttaacttctgaaaccaatcctgaatataaattctctttcttggctag
GGAGATCTTGTGCGAAAACTCAAAGAAGATAAAGCACCCCAAGTAGACGTAGACAAAGCA
GTGGCTGAGCTCAAAGCCCGCAAGAGGGTTCTGGAAGCAAAG
gtgagtcctgggatgctaaaataggaacataagtaggtataggattgttcatctttaatt
tctttggatgggagagacctagaaaagtttctgaacaagtatcatttggtttatctgttt
atccataatgccgccttctcctttccctctacctggtagactcctcatcctttcaaaatg

 1.03 Intr +   6583   6685  103  0  1  101   94   143 0.999  15.03
tttatattactcaaagggaaaaaaagacctatggcttctattgtttttaacctatcaaaa
tcttgtctgtttgataaattttatatttaattctggtgaggaataaactaaattcagata
tataagttcagattcccacccacccctccactcactcactttttatttaatctctaacag
GAGCTGGCGTTACAGCCCAAAGATGATATTGTAGACCGAGCAAAAATGGAAGATACCCTG
AAGAGGAGGTTTTTCTATGATCAAGCTTTTGCTATTTATGGAG
gtaagggattaatgacaaaaagaactattgtgttgttagtggctctaatattatacttaa
atcaagaacatggcttgcctgttggtatccacttgtatcaggccacaaagcagaggatgg
atgttttgcttttgtttgcttggagtcaccatttggtgtgatacctgttatttttctcca

 1.04 Intr +   7695   7836  142  1  1   87   50   109 0.970   5.49
gagcttttttattttacttccatcagctagctgaaagtaaggttcttcagtattgaggga
tttgcattgttgacttgaatacacttttagggagtataggtatcagtttctcatgtctcc
ttgccttcatttgttcagagtaacaaggtaaagtatgtgttttcctctcatattctatag
GTGTTAGTGGTCTGTATGACTTTGGGCCAGTTGGCTGTGCTTTGAAGAACAATATTATTC
AGACCTGGAGGCAGCACTTTATCCAAGAGGAACAGATCCTGGAGATCGATTGCACCATGC
TCACCCCTGAGCCAGTTTTAAA
gtgagatcttactttggagtgggggtatcctactttaaataaaataacttattaaattat
ttaatatacttatctaaataacttcctgattataaagaactactcatttcatgtagaaaa
tctgaaaaatatggaaaagcaaagaaatgtataccttctgctcacagatagctatgttaa

 1.05 Intr +   9670   9758   89  1  2   23  100   102 0.899   3.60
tagatttgaggaagaattttctctggcatacattactgtcatggatacatcattactata
gatatgggagcttccatctttgagatggatataaatattgatggggaattatcttataag
gtaatatctatgtgtaatttgtatgagaatgacaaattgggttggcatttgttaatttag
GACCTCTGGCCATGTAGACAAATTTGCTGACTTCATGGTGAAAGACGTAAAAAATGGAGA
ATGTTTTCGTGCTGACCATCTATTAAAAG
gtgaggttcttcatctccttcaggtaggattgatcaaaataaaaggtttaaactttctct
cagatgtctttcattaaattttttattgaggcataacattcaaagagcaaagtgcacaga
tcttaagtatatagatcaagtcctttattttttaaaaaagttatatgtagataattagtt

 1.06 Intr +  10132  10208   77  2  2   73  109    67 0.930   5.62
ttttctaattagcaaatgaatcaagacaataccatgactgctgttgtaaaatcaactgtg
ggattcatgtaaattaagaactttatgcttggatttactttttaattgtctagcattgaa
actgaaaagtgcattgtactttttcccattgattgatatatgtcaacactgttcttacag
CTCATTTACAGAAATTGATGTCTGATAAGAAGTGTTCTGTCGAAAAGAAATCAGAAATGG
AAAGTGTTTTGGCCCAG
gtgagtactctagagatgttatcagagtaacctaggtggtcgctgtccttctttcagtgt
ttaatgactgttgcatttcccattatgctgaccctggccacattgtaatgaagcagaggt
taattctgtcctgtatagcgtctctttttttgcatttttattttcttctctcttttgtga

 1.07 Intr +  16222  16367  146  0  2   78   71    82 0.994   3.66
aatggaaagtgaataaattggttatggttttaatgtgggtgtcctgaaggttaggttaat
tgtgatgttcctgaattttgtgtgattgtagcagtggatggctagggttatatataatac
tttatatcttatgccttgttttctctgtcttttacactaatttctttatatgtcttttag
CTTGATAACTATGGACAGCAAGAACTTGCGGATCTTTTTGTGAACTATAATGTAAAATCT
CCCATTACTGGAAATGATCTATCCCCTCCAGTGTCTTTTAACTTAATGTTCAAGACTTTC
ATTGGGCCTGGAGGAAACATGCCTGG
gtatgtatcacttattgtttacctgtttatgtaatgaagtttttaaaattgcttatatta
aaaggtaaatatcaatgttatgaaggaaaaatttttaaaaagtgatatacagaagtacag
atgaatgtattatggagaaataatggcagaaataaatcttttaaaaaattctttctgaat

 1.08 Intr +  18733  18882  150  1  0   68   84   101 0.982   6.06
acgtgctatgaaaatgtttgctaccgaggaaaatatttctaaaacttcattttagggcct
gttcaactttgttgtgaaaatggtatatttaggacttttaggatttgtatctagaatttc
aggattgttggaaaacataatttctttctttgtaacagactgacttacttaaatttatag
GTACTTGAGACCAGAAACTGCACAGGGGATTTTCTTGAATTTCAAACGACTTTTGGAGTT
CAACCAAGGAAAGTTGCCTTTTGCTGCTGCCCAGATTGGAAATTCTTTTAGAAATGAGAT
CTCCCCTCGATCTGGACTGATCAGAGTCAG
gtactgctcaggttactcttacaaattagtgaatgaccttggcattgcattgaaaatgaa
agcttgctgttttgaaacaattctgcttcataatcctgattatgaatttatttttgtttt
ctccaaaaatcatgttttacatttggaatctctaaatgtaatctccaggatgacaggcag

 1.09 Intr +  22533  22695  163  0  1   91   91   200 0.984  19.66
tttaattcaaaatttttttggccattcccttaggaaaccaactttctgtttagtgaaaaa
gaccactatagtatggagcctttatcactagaatgcagttgaaaatagaggccttgtttt
ttgtttgtttgttttttgtagttaaatatgcaggtttatcgcttacgtttttgctttcag
AGAATTCACAATGGCAGAAATTGAGCACTTTGTAGATCCCAGTGAGAAAGACCACCCCAA
GTTCCAGAATGTGGCAGACCTTCACCTTTATTTGTATTCAGCAAAAGCCCAGGTCAGCGG
ACAGTCCGCTCGGAAAATGCGCCTGGGAGATGCTGTTGAACAG
gtaggattctggaggtaacttaacttagattgtgcctgttcagggtttgcagcaattagc
aaattctatgtgttctgggtgacaagatattttattttggcagtcatttgcttttttaca
gtacttggttttgtacagaatttgttatacagtattattatagtaagagaaaaatcacct

 1.10 Intr +  23751  23915  165  2  0   45  102   222 0.998  18.54
aaataaccaagatctcattctgagtatttgaaattgttttgaaagcaagataaaatagtt
tgtgttgggtgtcaaatatttttcagtagagtgagtcaatggaaaccgatatcttggctt
tgaagagtattaatgtgtgttttcttttcttcctccatgcttgcttattggttggtttag
GGTGTGATTAATAACACAGTATTAGGCTATTTCATTGGCCGCATCTACCTCTACCTCACG
AAGGTTGGAATATCTCCAGATAAACTCCGCTTCCGGCAGCACATGGAGAATGAGATGGCC
CATTATGCCTGTGACTGTTGGGATGCAGAATCCAAAACATCCTAC
gtaagtggagtgctgtttaccatgtgattttcacattgttaacttagaagcacaggtacc
aaatgaatttttgtgcactttatgtcacagaggaacaaagggaaaagaaaagagatcttt
tcctgagcaaaacagaaaaagcagttgcctcctgcctttttataagtgtcctaaggagct

 1.11 Intr +  28028  28147  120  1  0   82    3   106 0.227   1.27
tattagctgcctgatatatgaggctattcccatttcaaatatttatgaaatttgaatgaa
gattatatcatcgaattatcattgaatatatgaaaggtttataatctgcatgcatttgtg
aatgaacccaatataagtaataataagtaagtaatgtttttattgattatatctttttag
GGTTGGATTGAGATTGTTGGATGTGCTGATCGTTCCTGTTATGACCTCTCCTGTCATGCA
CGAGCCACCAAAGTCCCACTTGTAGCTGAGAAACCTCTGAAAGAACCCATATCCTTTCTG

gtcactccaaaaactcaggattcacatgtgaacatcttgctaatgaataagtccaagtct
ttaccttgttctatggataaatggagatgttttagacactgtagtaacgcttgtttaaac
ctattattttacctatccctttgttcctttcctattctctgtacttgtagtctgacgtgt

 1.12 Intr +  28973  29097  125  1  2   -5   90   155 0.336   4.86
ggacaggtgtttcatcttgccttaaaatcagcataaacaggatctggagtactgatagag
agctggcatggttttaagttgatgattgattgttctcaggctcattttctgaaatactga
ggcagtgctgtagttttggattccttgactacttcatacaaaacagtcaatgttgttcag
TTTGAACCCAGTAAGGGAGCAATTGGTAAGGCATATAAGAAGGATGCAAAACTGGTGATG
GAGTATCTTGCCATTTGTGATGAGTGCTACATTACAGAAATGGAGATGCTGCTGAATGAG
AAAGG
gtaagatatcagatgtttactcttccatgggctccagtcagttgtgtcatctgccaggtt
ctgaaaggatgagattaatttcttaagattttttgcaggtaagtactgtatcttggctgc
atttaaaagactgtctttgccgagattttggcattatagcctgaaaaaagatttgaaata

 1.13 Intr +  32869  32954   86  1  2   92   54    37 0.506  -0.76
gactaatgcttaatttggtgtttcttatgaaataatttaaatttgacatcacttattata
tctggagagttgatcaagttataaaaagaaaaaacaacttagcaatctacaaaattcctt
taaattaaggcacagggtgcctgtttgaactaatacaaaatgtgttttgtttcttcgtag
GGAATTCACAATTGAAACTGAAGGGAAAACATTTCAGTTAACAAAAGACATGATCAATGT
GAAGAGATTCCAGAAAACACTATATG
gtaaatttgtaaaaataataaacaaaaagtcactgctccttaaagcttttgttgttgttt
gagacagggtcttgctctgtcacccaggctggagtgcagtggcacaacctctgcctcccc
ggctcaagcgttcctccctcctgtctcagcctccgaattagctgggactacaggtgcagg

 1.14 Intr +  38882  39072  191  0  2   52   55   239 0.970  15.38
ttggattcccgcaagggatttattaaactttagggatatttctttctcttgcaactcaac
ttgttgctttcttgtcttggtcccatttataagtctcctgagcttgtaagacagtagtta
gataacactgggcttaactccattgttttatttttaatttactttgtttattttggatag
CGGAAGCCCTGACCAGGCATGGAGTATCTCACAAAGTAGACGATTCCTCTGGGTCAATCG
GAAGGCGCTATGCCAGGACTGATGAGATTGGCGTGGCTTTTGGTGTCACCATTGACTTTG
ACACAGTGAACAAGACCCCCCACACTGCAACTCTGAGGGACCGTGACTCAATGCGGCAGA
TAAGAGCAGAG
gtatctggccttctctttggcatttttagccttagaaatgtgtactgcttcttactgatt
tgtgttggattttgatgtgtttatgctccctttcctttttttttctttttaattttaatg
aacggcttgtatcagacagagcccagattctcaagtcccccggtttaattatgaaaatat

 1.15 Term +  40370  40495  126  1  0  100   55   140 0.995   9.20
ttgtggcagaattgagttgtctgggggaactggtgggcgttttgggctagaagagcatga
acccatgcctggcatgacattgtttggctctgtgtaaggtttcctgagttcaggatgaat
cttcttcttaaaaatctgaacaagttggttgatacttggcttctctttccttgtctctag
ATCTCTGAGCTGCCCAGCATAGTCCAAGACCTAGCCAATGGCAACATCACATGGGCTGAT
GTGGAGGCCAGGTATCCTCTGTTTGAAGGGCAAGAGACTGGTAAAAAAGAGACAATCGAG
GAATGA
ggacaattttgacaacttttgaccacttgcgctaataaaaaaaaaaaaaaactactctta
tgtccactttacaaaagaaaacagcattgtgattactcccagggaccgtattttatcttc
agtggctgcctgattttacccccacaattaaagttgaaggaatcctgaacaaacttgtga

Predicted peptide sequence(s):


>GARS_1|GENSCAN_predicted_peptide_1|668_aa
MPSPRPVLLRGARAALLLLLPPRLLARPSLLLRRSLSAASCAPISLPAAASRSSMDGAGA
EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVD
RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDC
TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEME
SVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPET
AQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEK
DHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKV
GISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPL
VAEKPLKEPISFLFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIE
TEGKTFQLTKDMINVKRFQKTLYAEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVT
IDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQET
GKKETIEE