GENSCAN 1.0	Date run: 16-Jan-104	Time: 21:29:55

Sequence FKBP6_1 : 32662 bp : 48.65% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    876   1148  273  2  0   49   62   227 0.976  11.20
aggtgccccatcatttcccgctcgctctcgttacgtacccagcctccggcccctgtaagt
gccccatcgtgctctctgtcgctccagttagatgccccatcctgccccgcgagctccaat
tacgtgccccacctaaccccccacgtccgtgcctcatcatgacccgcacgctatggttac
ATGCCCCGCCTCGCGCTACCGCGCGTGCCCCATCATGCTCTGCGCGCTCCCATTACGTGC
CGCCACCTCGCGCCCCTGCACGTACCCAACGTGCCCTGCGTGGTCCCGTTACGTGTCCCA
TCATGTTTCGTGCGCTTCCATTACGGATCATACCTCGCACCTCACCGCGTGGCCTCTGTA
GTTCCAGAGCTCGCGAGGGCCAGGGCCGTTGGCGGCGGTTGGAACGAAACGATGAGTGCC
TCCTCGTGGCCCCAGAATGGAATGCCGCCGTCG
gtaggggtctgccgggcataaaggggccttcggaaccccaccagagtcacagccagggag
ggcagcggggcgcaccaggccgaaggctcacgccacagggagggcagctaggacatgggg
ggaagcgcgttaaaccagggagtcctggaaggggacgacgcccccggccaggtgagggcc

 1.02 Intr +   1409   1526  118  1  1   60   73   239 0.996  19.64
cgaaggctcacgccacagggagggcagctaggacatggggggaagcgcgttaaaccaggg
agtcctggaaggggacgacgcccccggccaggtgagggcccagacgtttcgggggcgtag
acgctgaggggtggccgggtgggtctgcggctctgaggcctggctttcattctccatcag
TCCCTGTACGAGCGGTTAAGTCAGAGGATGCTGGACATCTCGGGGGACCGGGGCGTGCTG
AAGGACGTCATCCGAGAAGGAGCTGGAGACCTAGTGGCGCCTGATGCTTCGGTGCTAG
gtacgccctggggcggtttgtcctcaggatccatgtcatcgcactctgttgggaagagag
aggcctcattttcaaaaagcacttaatggggttggaaatgctttgtttgaagtggatttt
tgttttttgtttttgaaacggggtcttgctcagttgcccaggctggagtgcagtggtgcg

 1.03 Intr +   2984   3186  203  0  2  111   87   146 0.999  15.80
aataaaatttctatcagtagaagctgggcacaggctcaggaggaagacattgcaggaaga
gggaactgtgtgagggagacatggaggccagagtactgctgacttagagggggaagaaac
tgatagcactgagcaggatactgagcaagcttcacccaccttctttgtccattcttacag
ATATTACACTGTGGGGCATGGAGCTGGGCCTTCTGAGCATGCGGAGAGGAGAGCTGGCCA
GGTTTCTGTTCAAACCGAACTACGCCTATGGAACGCTGGGCTGCCCTCCCTTGATCCCCC
CAAACACCACTGTCCTGTTTGAGATTGAGCTGCTTGACTTCCTGGACTGTGCTGAGTCAG
ACAAGTTTTGTGCTCTCTCAGCT
gtaagttccagagcacagatgtcagcactttatagagagacgaatgggttggtgttattg
gtaattcttctagatggcctgccctgaggctgatcgtcctctccagggtacccccgcggc
tcctgtgcggtggcggcggagttcctctgcttcctagtctgtgtttgtcttagtaatggc

 1.04 Intr +   4491   4610  120  2  0  100   76   131 0.769  13.79
agagctcacagctgtagtaacacttcctttctttcaattactatttttttaaatggagac
atgttctcactatgttgcccaggctggtctcgaactcctgggctcacgtgtactaacact
tccattgtggcattactgcttttggtttccttgctgaatattcctgtctctggtcctcag
GAGCAGCAAGACCAATTTCCACTTCAGAAGGTCCTGAAAGTGGCAGCTACGGAACGGGAG
TTTGGCAACTACCTTTTCCGCCAGAATCGTTTCTATGATGCCAAAGTGAGATATAAAAGG

gtgagaatgctttgaaagttaagtgtaagtttagatcctgaaaacttccttgtttaaaaa
acacagattttgttttgttgtgatttttgttttgttttgtttttgagacaagagtgtcgc
tctgtcgcccaggctggagtgcagtggcgcaatctcagctcactgcaagctccgcctcct

 1.05 Intr +  13471  13665  195  0  0  154  109   244 0.999  32.71
aacaagactccgtctgaaaaaagaagaaaaaagaaatatacctgacttcttatgttgatc
ttgtgtcttgcaacctgtaacagccgatttttagctctgatagtttttgcgtgtggattc
tttagggttttgtacataagactgttactcctcttgaccatctgccttccctctccacag
GCCCTGTTGCTTCTGCGCCGGCGATCAGCACCCCCTGAAGAGCAGCACCTGGTGGAGGCC
GCCAAGCTTCCTGTTCTCCTGAACCTGTCCTTTACATACCTGAAGCTAGACCGACCCACC
ATAGCCCTGTGCTATGGAGAGCAGGCTTTGATCATTGACCAAAAGAATGCCAAGGCCCTC
TTCAGGTGTGGACAG
gtgagttggaagccagtgacttgggaataaacacccaggaaaaggtagtagcagtgctca
actcagctactgcaaaaatgctgtctttttttttttttttttttttagacagagttttgc
tcttgttgcccaggatggagtgcagtggcgcaaattcggctcgctgcaacctccgcttcc

 1.06 Intr +  14103  14212  110  2  2   68   71    95 0.991   4.88
tttgtagttttagtagagatagggttttgccgtgttggccaggctggtctggaatccctg
acctcagttgatccgcccgccttggcctcccaaagtgctgggattacaggcatgagccac
cgtgcccagccaaatgatatcttttctaactgtgcttttaaagttctctccttgggacag
GCTTGTCTTCTCCTGACTGAGTATCAAAAGGCCCGGGATTTTCTAGTTCGAGCCCAGAAG
GAGCAACCCTTCAATCATGACATCAATAATGAGCTGAAGAAACTGGCTAG
gtgagctgtgtttgcaggagcatgaagagagatgggtggggttgtgactctggtctgtcc
ccccaccccccccaacaaaggacagtctggcggtgttgcccagagtgttaggaggccgcc
ccctctacagctgggtttttgaagtgctcggccgtgcgctgcaccagcagttcccagcaa

 1.07 Term +  15638  15728   91  2  1  112   49   111 0.991   6.79
gccagctgtgggagccttccctgcctccccacctctccagcttacttccatccctcccaa
ctcagtttgagtcctgataaattttcagtgtttctggatgtgagtggagaattccagcca
ccagatgtcacctcctccaaacacagacctcctctaacgagtgtgtatttccctctccag
CTGTTACAGGGACTATGTGGATAAAGAGAAAGAAATGTGGCACCGCATGTTCGCGCCCTG
TGGCGATGGTTCTACAGCAGGAGAAAGTTGA
aggtaatcaaagggccagggtggcacacaggcttccggatggagaagcgtgctgctctcc
tccacccccaagtgaatggtggctgtctgcagctgagggtggacgaggggtagacaagtt
ccttgctgtaaagaacaacacaacggtagtgcaggatgcacgtgctgcacgcctaccttt

 2.01 Init +  25346  25482  137  1  2   67   34   136 0.482   3.81
tatcggcttagtctgtttttaatttcttgcgttcattaggtgcataagccctgcctccaa
gcatacataatcccaaacaccaacctggataattaagtgtacaggtagtgagtgaaagaa
gtgagcctaagcaataaggaattgacatcaagccagtgccttgtaccttctagggagagc
ATGAGTCCCCGCCAGCTTTGCTGGCTGACCCCCATTCTGCAGGTGCTGATCCTGTTCTCA
AGACCTTTGGTTGTAGCTGTTATTGACTGTCATACTTTTGATGCTCCCCTACGCTCCCAA
GCAGCCACCGACCCAGG
gtgaagctgagatgaactggggtgagcctcagaggttcaagaatccagagaagggttttc
aaatctaatagataagtgaagagctatgagcaaaagttctctctagctcagaggtcactc
agacattcacaaggtgagaaggatgtggtctgccgtcactgtgagtgcacccacagcagt

 2.02 Intr +  26905  26996   92  1  2   53   67    40 0.032  -1.96
caccacgcccggcttatttttgttatttttagtagagacgaggttttaccatgtaggcca
ggctggtctcagactcctggcctaaagtgatcctcctgccttggcctccctaaaccttgt
ttttaaacaagcgtggcagtttggatggcactttgacccttctttgaccatgtatcacag
CACAGTGGCAGCTGGTGGTGGTGAGCTGCAGTTGTTGGAGGAAGTGCAGCAGAGCCATGC
TGTGAGGCCTGGCCCACCCCCAAAACCGGGAG
gtacctgcaggcgctctcattccatgtcagcctggaaagggtgggctccagaccactcag
ctccatgcgcattctcatgggactaggtggccagttgtgacagtggggaagtaatcgcac
tccctgcagagggacgtggccaagggaggagcagagagctgggctggtggagcacgaggg

 2.03 Term +  31021  31166  146  2  2   70   47   101 0.010   2.27
aggtttcccagagcccatctagtagggccacacggtgatggcatctgtctcttggctcct
gtgtggtcaccggccatgcccttccctgacctcagctgctagccctcagcacatgtgact
gtgacgtcgtgtggcagctgctgagtcctgagatgtttttaatggctgtttgattcccag
GTTCTTCACCTACCAACGAGGGGAGAGAGCTGTGGTTCTCCATCATTGGGGGAGTGGAAG
GGAGCTCCCAGCGCAGCCGTGGCAGCCACCTTCCAGGAGCAGGGGCTGGAATGTCCTGTG
GCCGCATCTCTCATGGACGCGGCTGA
aacgtgttttcacaggtgctgttttctgttttccgtgttcgtaacagaagggaggggaaa
gcgcagctactgacaagtagaacactgctactttttttaaggcagtttcttgttttttta
gacggaattagtccttggcttccctcccagtcccagccctgcttccggctgcgaatgtcc

Predicted peptide sequence(s):


>FKBP6_1|GENSCAN_predicted_peptide_1|369_aa
MPRLALPRVPHHALRAPITCRHLAPLHVPNVPCVVPLRVPSCFVRFHYGSYLAPHRVASV
VPELARARAVGGGWNETMSASSWPQNGMPPSSLYERLSQRMLDISGDRGVLKDVIREGAG
DLVAPDASVLDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIE
LLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRAL
LLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFR
CGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPC
GDGSTAGES

>FKBP6_1|GENSCAN_predicted_peptide_2|124_aa
MSPRQLCWLTPILQVLILFSRPLVVAVIDCHTFDAPLRSQAATDPGTVAAGGGELQLLEE
VQQSHAVRPGPPPKPGGSSPTNEGRELWFSIIGGVEGSSQRSRGSHLPGAGAGMSCGRIS
HGRG