GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:30:08

Sequence FAM3C_1 : 49814 bp : 35.95% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +  14509  14521   13  0  1   90  110    12 0.099   4.00
tttttttaatgccaatgttggcataatacttagaaatgtcataaaatttactagtttata
tgccccatttcaaactcaatctaaggaggaatgtttgctctagagctaatgatatttgct
ttttgttttgattttttaggagcatattaatgaaaagtgccataaactgaaaaaccaaac
ATGAGGGTAGCAG
gtaagatatttaatttagtagaagtaattgtactttttgtgtaacctgtttgttaaagaa
taactaaaggagaggttaaataatctttatattgagaaggttaaactgaaataaactaaa
tcattcagccctttgtttttaggtagttggcaaatcacaaattggacatttagtcagtat

 1.02 Intr +  18463  18567  105  2  0   80  111     6 0.070   1.37
aattctttatcttgatgaattgtttgtataatttttatgtatctcatgtaaaattaagat
ctaatagatacaaagtagaaatgtattgatcttaaaaaatttataaacatttttcataga
aatgcaaaataaaagttctgtgggcttacaaagttatgctgaaatacttctgccttttag
GTGCTGCAAAGTTGGTGGTAGCTGTGGCAGTGTTTTTACTGACATTTTATGTTATTTCTC
AAGTATTTGAAATAAAAATGGATGCAAGTTTAGGAAATCTATTTG
gtaagttttatttttttcctttcttaaatcttatttttgatgtggcctaaagttttatca
gttatcagcactgagtcactcagtgctagaaaacgaaatgtgattattatatatccataa
atatgatttgttagaatattttacagtatataattagatattttggaattaatttagtat

 1.03 Intr +  26035  26158  124  2  1   66   75    58 0.088   1.02
tttaaaaaaattttttgaggttctttgaaaccctcaggggaaaaaattagcttgtatttt
aagatacgtgtatcttgatgtttttcttaatgctctttgtggtttgagatttgaagtaaa
gtgaggtaaagtctgttaacttgttttctaaaaaaagacatcatgttttctcccccaaag
CTACAAAGCCTCCCAGATATAAGTGTGGGATCTCAAAAGCTTGCCCTGAGAAGCATTTTG
CTTTTAAAATGGCAAGTGGAGCAGCCAACGTGGTGGGACCCAAAATCTGCCTGGAAGATA
ATGT
gtaagtctttgttgacttgagacgataaggtgtgctattaaattgcagccaattgaacct
gagtttaatggatattttgaaaatgtgttcggtatactttattaatggaaagtgatttcc
atttttgttatgtagtttttttctcatgaattcaagggaccttaaagttcttaaatttta

 1.04 Intr +  33269  33327   59  2  2   96   95    33 0.709   2.41
aaattattcagtattagactgtcttctctgacttagtagagatctttttaatttcctccg
cagcactgaacaattgaaaatatgtataatattcctaactttttttgcaagactttattt
ttctgatatgttattgtacaatatttaattctaaatttatttcaatttctcccccttcag
TTTAATGAGTGGTGTTAAGAATAATGTTGGAAGAGGGATCAATGTTGCCTTGGCAAATG
gtaagaacaattattttagcttatggatgtaatcattgggtatttttctgtcccaaagta
aaatgcactatcagaggatcaggttagaaagtactgctcttgatgataaagccctctgtc
ccatccctgccctgcaaaaaatctatgggtggagacttggtgtctaagaatttatagcgt

 1.05 Intr +  34510  34560   51  2  0   93   99    30 0.667   2.56
atgattcagattttaagttctcaaagtaattctttgagatgaattcacatctctctaatg
ctaatgaattcacatcttctctgctaatgaattcacatcaatcattggatgagattattg
gtcttacagtgtatgatatatttcagatgcataatttgatatgaatttaatctcttttag
GAAAAACAGGAGAAGTATTAGACACTAAATATTTTGACATGTGGGGAGGAG
gtaagcataaataacatgactgtgttcttttgctggcactaacttaatcacctcaataca
atgtagcccattaacgagagaatgatgatgctatttgcgttagttcattttgtttccctt
actttctgttcactaaatgtccagctgtatttaagttatcattcatgttttatatacttt

 1.06 Intr +  37330  37414   85  2  1  119   55    76 0.560   5.36
gttaagggacaaatttaacagtttttaaactctttatgagatttgtctgtcttttggatt
actttacattggaaattattgctttacagatacttcatgttttataatactactttcaga
gattatcgtgatgcttattcagtcattttttaaaaccctaaaccctttctttttcttcag
ATGTGGCACCATTTATTGAGTTTCTGAAGGCCATACAAGATGGAACAATAGTTTTAATGG
GAACATACGATGATGGAGCAACCAA
gtatgtaaacttaaaactttacagaactttttggaactataatttgtaattataaaagca
atacattttcattaaaaaaaaaatctgtaacatagagcaaagtaatcaaactaccaggta
aacacaactaacaatttttgtttttactttgcctccttcctggttttatatgtaaatgtt

 1.07 Intr +  46199  46325  127  2  1   80   92    37 0.094   3.06
tcttttgtcactaaagaattcaaccagtagaaatgtaactctgaaaaaaaattattttcc
aaaatgttctgttatttaaagtctcattttgtctcatgttttgtgttaatatcccagtga
accagtattagcatacagttccctctgtttattgttgtattctttctctccctcttcaag
ACTCAATGATGAGGCACGGCGGCTCATTGCTGATTTGGGGAGCACATCTATTACTAATCT
TGGTTTTAGAGACAACTGGGTCTTCTGTGGTGGGAAGGGCATTAAGACAAAAAGCCCTTT
TGAACAG
gttagtgtcatagactctcagaattaacaaaaacaaattctgtgaaaccttacggtacat
tttcccatcccagctatttgaaaattagataaagcggatagtaaatatgatcatatattt
gtcataaattcttggtaatcagttatttgaaataactatcgtacttttaaatttcaaaac

Predicted peptide sequence(s):


>FAM3C_1|GENSCAN_predicted_peptide_1|188_aa
MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFATKPPRYKCGISKACPEKHFA
FKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVA
PFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGI
KTKSPFEQ