GENSCAN 1.0	Date run: 16-Jan-104	Time: 19:00:04

Sequence EZH2_1 : 79339 bp : 39.67% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1213   1359  147  0  0   83   92   215 0.968  21.54
ccgccgcccgcgcgcgcacgcgctgccagtgcccgcccgcccacgagccctgagcgcact
ctgcgtggggctggctcggcgcctccgagcccggcgggccctgtgattggacgggcgccc
gcctcgcgtcccgccaatcggggcggcgcttgattgggctgggggggccaaataaaagcg
ATGGCGATTGGGCTGCCGCGTTTGGCGCTCGGTCCGGTCGCGTCCGACACCCGGTGGGAC
TCAGAAGGCAGTGGAGCCCCGGCGGCGGCGGCGGCGGCGCGCGGGGGCGACGCGCGGGAA
CAACGCGAGTCGGCGCGCGGGACGAAG
gtaacgcgccgctgcgggcggcccggccggcggggctccgggagtgcgaaccgggcggcg
gcggcggcgccaggacctccccgccactgctgtgccggtcccgggtatcgccgagcgggg
ctcaccggggcgccgcgtttgtaggcgtgcggggggtggagggtgaggggagagcccccc

 1.02 Term +  17326  17457  132  0  0   17   44   134 0.112  -0.99
gtgctggcttcccctttgctttccactgtgatgataagtttcctgaggcttccccagcca
tgcttcctgtatagcctgctgaactgtaagcaaattaaacctcttttctttataaattac
ccaccctcagctctttatagcaatgtgagaatggactaatacagaaaatatgtaccacag
AAGTGGGGCATCACAATAAAGATACCTGAAAATGTGGATGCAGCTTTTGGACTGAGTAAT
GGGCACAGGTTGGTACAGTTTGGAGGGCTCAGAACAAGACAGGAAGATAAGGGAATGTTT
GGAACTTCCTAG
agacttgttgaatggttttgaccaaaatgctgatagtgatatggacagagatggctaggc
tgatgaagtctcagatgaagatgaggaacttattggggaactggagtaaaagtcactctt
gctatgtgttagcaaagagactggcagcattgtgctcctgctctagggatctgttgaact

 2.01 Init +  38225  38341  117  1  0   76   70   152 0.941  12.45
gaagtgttttaaggatttaaccatgcagcacaaatgagcacctttctgtaaatgccaaca
gtgtaatatgtgtcatttcttcactgattgttagtttgctgcggattaaaacacaggtga
tcatattcaggctggttagattagtgattttaatatgaaaccattgcttttagaataatc
ATGGGCCAGACTGGGAAGAAATCTGAGAAGGGACCAGTTTGTTGGCGGAAGCGTGTAAAA
TCAGAGTACATGCGACTGAGACAGCTCAAGAGGTTCAGACGAGCTGATGAAGTAAAG
gtataattttatcttttgtgaaaatgaatatacaattaaggataggttttttcccctcct
aagttcaataagtttttatttaaaataattctagccaagtttgtatttacaataagatga
gtgaatacttggaagcttaggttcttgatctgtcttaacattataccatgcacattaatc

 2.02 Intr +  38925  39053  129  2  0   79   73    78 0.853   5.37
gatgtggtgtttttgtattatttgaatgtgggaaactatagtgtaaaatctatatgcacc
taagaaaatgttcttgatatttttgaggatacactagatttttaacctgctttacaggtg
ttatacattttctaacaatgaacaatttctcctttcctctccttcatttttttttttaag
AGTATGTTTAGTTCCAATCGTCAGAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAA
TGGAAACAGCGAAGGATACAGCCTGTGCACATCCTGACTTCTGTGAGCTCATTGCGCGGG
ACTAGGGAG
gttggttaacataacatgttgtagtaattatcatcatcttttggtttatgctattggaac
atttgtttggttattgggaggaaatcattgacctcagggtgtccatctttttattgctat
ttctttttaatgtgcaactgttaatgactgctgtagatcacactattagctattcctata

 2.03 Intr +  48654  48701   48  2  0   78   95    33 0.362   0.96
agtgcttggcacatagtagggtgtgttaatttctttcccttccctgcaggccattcacct
gctcttccctctacgattttccataacacagtttttacttggaaccagccttctgccaag
agtctcagtttggttgtgtactcctacaactactatttttggcttgacttccctctccag
CTCCCAGTGGTCCAGCCACACAGTCGCCTATTGTACCAGCTGGTTGAT
gtaagtctatccatcctcagaggaacctggttacttaccagtaagctgtgtttctctgaa
aatgtagcatccttggtaatgattctagtcccccccatcccctttttttttaaaccattg
atgatgaatcatctctaacttccttgtgtgatcctcaagttggaactggaattagagaat

 2.04 Intr +  52773  52889  117  2  0   81   80    41 0.747   2.34
ccctaagtaaaagaaaagagagaatcctatttggtttatatgaccactttactgtcctag
gtaaggacttttttttcaaaattaaatatttgggtaggcagcatctctttacaatatgat
ggctacagcttaaggttgtccttttattcttaagagtcaattttattttttctgttttag
TGTTCGGTGACCAGTGACTTGGATTTTCCAACACAAGTCATCCCATTAAAGACTCTGAAT
GCAGTTGCTTCAGTACCCATAATGTATTCTTGGTCTCCCCTACAGCAGAATTTTATG
gtatgtaaataagatatcttctgcttatttgataataacttatttgaagtaaaaaagcat
agataattttattgtcaaggtgaatcaagacagtataaattctaaaaagctatcaaaata
acacttgaagtaatttttaaaaattgattaaggtagtttttttaaggcctgtgcagtatt

 2.05 Intr +  55675  55795  121  0  1  110   83    90 0.999   9.85
cttattggtgagaggggtcttttattttttgataaattttagagtttgctctctgactag
tattttaaatctggagaactgggtaaagacatgtacacatgaaaaaaaggttgtatttta
gttatttcacatttgatacttagagtaaacctgctttttaaatatatttttttcttttag
GTGGAAGATGAAACTGTTTTACATAACATTCCTTATATGGGAGATGAAGTTTTAGATCAG
GATGGTACTTTCATTGAAGAACTAATAAAAAATTATGATGGGAAAGTACACGGGGATAGA
G
gtgagccatatgcttcttctcttggaaaaaggggctaaagaattgagagacacttttgtt
tatgaagcatatagggcatgagaaaaattttaatattaaaattaagttttgcactgaact
ataagggactgaacctgggcccaggcctaagattttcagtattttccctaactatttttg

 2.06 Intr +  56643  56783  141  1  0   66   68   253 0.999  20.50
tgcttcctttgcctaacaccagtcctgaaaatgatcttatcttttcctcccctcatttca
ataataatgttttagtgccagttactaggctatgcctgttttgtccaagtagaaaaagga
tacataaacttttgacattattgcttctcctgtgtgtttctgacatttgatgcgtttcag
AATGTGGGTTTATAAATGATGAAATTTTTGTGGAGTTGGTGAATGCCCTTGGTCAATATA
ATGATGATGACGATGATGATGATGGAGACGATCCTGAAGAAAGAGAAGAAAAGCAGAAAG
ATCTGGAGGATCACCGAGATG
gtatgcctgattattaggattctgtgtagccattacagctttctttcaaaaacagtagaa
agagtagaaatagggcttagtttcttctttctctttttctttctttgttaaatatcacat
tgatagcagtataatcaaaattaacatattatggccaggtagggtggctaactctgtaat

 2.07 Intr +  58257  58359  103  1  1   75   69   128 0.997   7.91
tttttgactgactggcattccacagacatgtaaagtatgtgagaagtaagtaaaacacaa
aatagagatgatttcttagaaaatcagctttgttatagagacataattgggtagagaaaa
tgaaagatcaaaaacttgtttacttccattctttttttcctttcatattctcctgtttag
ATAAAGAAAGCCGCCCACCTCGGAAATTTCCTTCTGATAAAATTTTTGAAGCCATTTCCT
CAATGTTTCCAGATAAGGGCACAGCAGAAGAACTAAAGGAAAA
gtaagaatttgttcctttgaggcaatcttgccctgtatggtatgtaactcaccattttgg
tttattacaaatggaatcaatgtagcggatgagccactacactttgtttacagtgtttgc
aagatacttgaagcaacatgtgtacttgtggtactctgcattacaaaatatttcctgtag

 2.08 Intr +  58891  59054  164  1  2   50   97   112 0.982   7.00
atttgattcttgataacaccatgcacaatatttagttggctctttatctaaatagagcca
ttcctttatgttttaggcaagataaacatcaaaagtaacacatggaaaccttttagaaac
tgttttcaaaaaagtgatttttgtttcatgtttacttaaatttttcttggttaatgtcag
ATATAAAGAACTCACCGAACAGCAGCTCCCAGGCGCACTTCCTCCTGAATGTACCCCCAA
CATAGATGGACCAAATGCTAAATCTGTTCAGAGAGAGCAAAGCTTACACTCCTTTCATAC
GCTTTTCTGTAGGCGATGTTTTAAATATGACTGCTTCCTACATC
gtaagtgcaattattgtacgttttcattttctatctttgttgtggaattatgttttaaag
cagcttggagagtgctatcatttattacaactagaatttatcatttaatcttgtagttac
tttgacaaatatctttagatctcagtattattatttttactttgttgcttgaggattgct

 2.09 Intr +  65836  65927   92  2  2   71   91    95 0.999   6.89
aggaatggagaatacgttgtgatcattcagtaagagcctgaaggaaagttgtatgaagta
acgtaaaccacatattagcaagattataatccattaattgacttttccagtggaactgga
agagtgaaaaagtaagtattttatagttatattagattctttgtttcatttattttgcag
CTTTTCATGCAACACCCAACACTTATAAGCGGAAGAACACAGAAACAGCTCTAGACAACA
AACCTTGTGGACCACAGTGTTACCAGCATTTG
gtaagacttagtgcctaattattgcagagggtacttgagaggactttgcactttggtgga
ggtgatcaagtcagcgttaatgttgtctgcacccatgctgttatgggccatatgatagac
agagctttctcacccatgctgtttcttccatagctcatgtactgcacattttagtccttc

 2.10 Intr +  67406  67646  241  1  1   83   99   292 0.999  26.00
attttcagactatcaaaagcatatcaaaacaagtatattagacatgcaaatgattatttg
tgataaatggataatgtgatacattttttgactaacctggcttatatagtattttttttt
ctcttccatcaaaatgagttttagaactttgccctgatgttgacatttttcatttcgtag
GAGGGAGCAAAGGAGTTTGCTGCTGCTCTCACCGCTGAGCGGATAAAGACCCCACCAAAA
CGTCCAGGAGGCCGCAGAAGAGGACGGCTTCCCAATAACAGTAGCAGGCCCAGCACCCCC
ACCATTAATGTGCTGGAATCAAAGGATACAGACAGTGATAGGGAAGCAGGGACTGAAACG
GGGGGAGAGAACAATGATAAAGAAGAAGAAGAGAAGAAAGATGAAACTTCGAGCTCCTCT
G
gtaagacacgtctaataactgggttttactgttctgtgaaagttcgtgttgtgaggatta
aggatgtataatgcattgaataattttcttagttggttagtttcagtataaagaccagag
ttatctcaagaatgtgtagctgtgttgtttctgtttcctgcctgcacccgtaccctagct

 2.11 Intr +  68111  68301  191  0  2   57  110   126 0.780  10.08
aatttggatcatttggtttaatattcttgacgttctgtgagtagttttgttggaaaatgt
gaactacgatgggttagtgttttgccgattggatttgagttgtcctcatcttttcgcttt
tttcttaagcacaccctgaattgtacttcttaatattatttccaatcatttcttgaccag
TGCTTACATTTGGTTTTGTAGAAGCAAATTCTCGGTGTCAAACACCAATAAAGATGAAGC
CAAATATTGAACCTCCTGAGAATGTGGAGTGGAGTGGTGCTGAAGCCTCAATGTTTAGAG
TCCTCATTGGCACTTACTATGACAATTTCTGTGCCATTGCTAGGTTAATTGGGACCAAAA
CATGTAGACAG
gtaagatatccgataaaaatgttgttaaaagagcttcaaacatagagataaaactgtact
cgttgtccaaacaaagaaaattcttggttattactaagctcctattcatctcctaaaaat
aatttttttttcttcccaagagggaattgaatgaaaattattctccaggtatgttacaga

 2.12 Intr +  68745  68839   95  2  2   95  117    81 0.937   9.54
gaccagaatataattacagctacccctaatgtgagggtagggacagcgatgtgtgttata
tccccagcatctagcagtgtcacagaagagacaaagacatttttctggtatgcatgagta
taagaatggtttgcctaaataagactgtcctcatggctctgtgactgtgcctcttgtcag
GTGTATGAGTTTAGAGTCAAAGAATCTAGCATCATAGCTCCAGCTCCCGCTGAGGATGTG
GATACTCCTCCAAGGAAAAAGAAGAGGAAACACCG
gtgagtctgtcatgaagctccttagagaagtcaacatagatagacactgcaggcaaggcc
cttcctaagggctgttgttggtttctacttagtctatttttaaaaaaccttaaactgcca
tcaaaaacagaactatggaatcttatttccactgggaattgctagtatttttctataaga

 2.13 Intr +  69308  69432  125  2  2   55   82    -1 0.432  -4.69
tacgtaaacaattactttaacatcatgaaatgttctgtgtttctgatgtgagctctgggc
cagtttttagaagtatcttttattccaggagcttgaatttctaagttgtgtggcattgca
ttccgatactcctaatgggtaccctactttaagcttgtgtgaatgttattttcaccttag
CGAATGTTTTCAGGCTGATTTGATTTGTAAATGTAGAACCAGAAAAATTGATGAGTGGAC
TATCTGCTCTAATCTCCCCATACCTCTACCTCACATTTTTAAAAATGAGAAACCTAATTG
GGTAG
gtaagggtgcagttagattatgcttcttaaattgtgtacaggctcatgttacattttctt
actttaacaaaaataagtgtagggccaacccaatttagaatttttttaaagtcaagtttt
tatttttattttttaggctttaggagatgcttctgaaattttggttgaattatttctgac

 2.14 Intr +  71386  71564  179  2  2   13  105   256 0.823  18.52
agtgcaaacagctataacttcgctgttaatacttccatttccttgtctatatagtagggt
aataaggtggttgtgagggttgagagtcagtgagatgcccagtacagcccttgccacgta
tctttctgcaagtttttgcatacggtgatgagtgaagaacctccaaacctctctctgaag
GTCAAAACCGCTTTCCGGGATGCCGCTGCAAAGCACAGTGCAACACCAAGCAGTGCCCGT
GCTACCTGGCTGTCCGAGAGTGTGACCCTGACCTCTGTCTTACTTGTGGAGCCGCTGACC
ATTGGGACAGTAAAAATGTGTCCTGCAAGAACTGCAGTATTCAGCGGGGCTCCAAAAAG
gtgagcaacaagtcacttctggaagattgtttgtagttagctatttagtgatgcaaatgt
caggattgccttagatgatttagctggggcaaaaagtaaaagtgatccttgaaaggtgca
actgatgagaaagtgttcataattttctctgggtaatgcacccttgggcagtctcttcag

 2.15 Intr +  73803  73898   96  2  0  102   94    62 0.910   7.49
gttcatagccattctcagcagctttcacgttgactgaagctgtgtgcccaattactgcct
tagaacaaacaggtctgaggatttacagtgatagcttttgttttcattctgtagtctact
ttgtccccagtccattttcaccctccttttttgatgatgtgattgtgttttattctctag
CATCTATTGCTGGCACCATCTGACGTGGCAGGCTGGGGGATTTTTATCAAAGATCCTGTG
CAGAAAAATGAATTCATCTCAGAATACTGTGGAGAG
gtaaggcactgataacctgtattcaggtggcattgtatatactaactttactttatttta
gattgattttattaggtaagtctgtgggtttgattggaaatgaattgccataaactgcct
tttcagcctggacttctgcatgtttgtggatttgcatgcttagtaactggattgtgctgg

 2.16 Intr +  75109  75190   82  0  1   81   80    13 0.927  -1.91
tagtatacagttattctttattactgcgcagaccgaatgggaaagagaacttggctgtag
tgaccctttttgttgcgttttctccagaaggtccagtattcactctgtgcgcttttgtgt
gttctgtcaggcttgatcacctttatccaaaagaattttctcctgtgtctttctttttag
ATTATTTCTCAAGATGAAGCTGACAGAAGAGGGAAAGTGTATGATAAATACATGTGCAGC
TTTCTGTTCAACTTGAACAATG
gtatgtttcagagctgggaggcagtgagttcctgagttgcatgtggcagccttctgccgg
ccgagtgttcagaaacgagggtagaggtcagtgaggtgaccagaaggaggatctccttag
aggcatggggggctgcttgcttgaaaggaactggagcaaggaattcctcagggagcagat

 2.17 Intr +  76133  76213   81  0  0  114  100    85 0.996  10.99
cctggaacaatagtgtgttcttccaaatgtcatttcttactgaatgaagctgcttgattt
atttgcttttgcaggcaaaccctgaagaactgtaaccagttgcatttacaaaatcataat
aacttggtttacttataactgaaattattcactgggctgtgcttacttttttctttttag
ATTTTGTGGTGGATGCAACCCGCAAGGGTAACAAAATTCGTTTTGCAAATCATTCGGTAA
ATCCAAACTGCTATGCAAAAG
gtaggtacctttgacgtgagaattggaactcccttttcagtcctgtgatgatggacttga
atacttctgggatagttgtttgttatgtgaacaagtcagttaaccccccgtggcccgtct
tcatgctcactgacaccagtgtgtctctttgcagttatgatggttaacggtgatcacagg

 2.18 Intr +  76368  76452   85  1  1  120   77    47 0.962   4.76
ggtaaatccaaactgctatgcaaaaggtaggtacctttgacgtgagaattggaactccct
tttcagtcctgtgatgatggacttgaatacttctgggatagttgtttgttatgtgaacaa
gtcagttaaccccccgtggcccgtcttcatgctcactgacaccagtgtgtctctttgcag
TTATGATGGTTAACGGTGATCACAGGATAGGTATTTTTGCCAAGAGAGCCATCCAGACTG
GCGAAGAGCTGTTTTTTGATTACAG
gttggtaaagtacatttctagcatgatctctaagggctttttctactggattgtgaactc
tggacaaaggagggtttttagttctttgcttcttttgatgggtcactttgccatgagcat
tagtggggaattaggttacactttcctgttatgtatttattatccatttatatattatac

 2.19 Term +  77817  77877   61  0  1   88   44   101 0.779   2.00
ttgccttctatgaatgtgccgttatgcaggcagctgtgtaattggatgggtttttttttt
ttttttttttttaaagacattttaatgcacccactatcttcagcaggctttgttgtgtta
agtctcagcacatgttggatgggtggccatccagcggacatctccttcctgttgtttcag
ATACAGCCAGGCTGATGCCCTGAAGTATGTCGGCATCGAAAGAGAAATGGAAATCCCTTG
A
catctgctacctcctcccccctcctctgaaacagctgccttagcttcaggaacctcgagt
actgtgggcaatttagaaaaagaacatgcagtttgaaattctgaatttgcaaagtactgt
aagaataatttatagtaatgagtttaaaaatcaactttttattgccttctcaccagctgc

Predicted peptide sequence(s):


>EZH2_1|GENSCAN_predicted_peptide_1|92_aa
MAIGLPRLALGPVASDTRWDSEGSGAPAAAAAARGGDAREQRESARGTKKWGITIKIPEN
VDAAFGLSNGHRLVQFGGLRTRQEDKGMFGTS

>EZH2_1|GENSCAN_predicted_peptide_2|755_aa
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRELPVVQPHSRLLYQLVDCSVTSDLDFPTQVIPLKTLNAV
ASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECG
FINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIF
EAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTL
FCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIK
TPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDET
SSSSVLTFGFVEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARL
IGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRECFQADLICKCRTRKIDEWT
ICSNLPIPLPHIFKNEKPNWVGQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAA
DHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEA
DRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIF
AKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP