GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:40:44

Sequence CPA4_1 : 33405 bp : 46.60% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1208   1275   68  1  2   91  106     1 0.751   2.76
agatgctcaacctttatcacttgaaaggaatgggagaggcattggtagggcctgcctgtc
acagtcagagttgcaagggtgcttgggaatcacattagcatttttgaggacttgagtcac
tctcagactctttataaatacagcttgactcagccactgtatgactgactccccggggac
ATGAGGTGGATACTGTTCATTGGGGCCCTTATTGGGTCCAGCATCTGTGGCCAAGAAAAA
TTTTTTGG
gtaagttccttttggacttattatttggttatttcagaaatatgggagccaaatggaact
gaaaatgaatggctgataatagctcacatggaggaagaagacctgggctcttgttccagc
tttgcccctgtgtcatcctggacaagtccactctcttctctgagaccccatttcatctgt

 1.02 Intr +   6777   6858   82  0  1  122   77    43 0.997   6.24
gcactttttcatagttgccatgtagcctcatttttaatggccatacattaaaaccaaaga
ctagaccatttcctttcttttggcctggttacgtctgggataggaggcttgggggtttct
ttgccagctgaaagctcatcattatcttttgctcttttttccttttcgcttcttccccag
GGACCAAGTTTTGAGGATTAATGTCAGAAATGGAGACGAGATCAGCAAATTGAGTCAACT
AGTGAATTCAAACAACTTGAAG
gtacctggttctttttagctctcctgagtgttttctaactttgctgggagaagactcttg
ctctactggcattattatttttatttctgaggagtctctgaatataatcctgtgggagtc
cacttgccatttatacaattgagggggctgatgggagagagggagcacatcacagctgtg

 1.03 Intr +   7301   7435  135  1  0  109   96    99 0.999  13.56
gatactgcttgttgggcaggtccaaccagacacaattgtgaaatgggcaaactttgccct
tgggcagagcctagcctctcagggatcaccctggcttttggcagtgttctagaagaataa
cctcattgtgcattttacctgaacggtcctttaacctggtttcatttctgttcccttcag
CTCAATTTCTGGAAATCTCCCTCCTCCTTCAATCGGCCTGTGGATGTCCTGGTCCCATCT
GTCAGTCTGCAGGCATTTAAATCCTTCCTGAGATCCCAGGGCTTAGAGTACGCAGTGACA
ATTGAGGACCTGCAG
gtaggtagactatgcctcctgcctcctgctcttgcataggaccaggcagccagtccagag
tagaccggagtgatttgcaagttctggttttatccttttctattttatagaccaggaaat
ggaggcaaatggaagtaaagtgcagtgacttgttagaggaacaacattttgtagtagaaa

 1.04 Intr +   8847   8945   99  2  0  101   87    96 0.990  11.11
gaaataaaattttataaagatatgaaagaaatctaacccccttttaaaccttgacatttg
tgctgcttgatatgctgaaagggccgccatcttggctgacccatatgcaaagatatggca
gaaaaaacataaacctgcgtctgcaatggatcacttcacaacattgctgtgtgttttcag
GCCCTTTTAGACAATGAAGATGATGAAATGCAACACAATGAAGGGCAAGAACGGAGCAGT
AATAACTTCAACTACGGGGCTTACCATTCCCTGGAAGCT
gtaagtgtttcagagtgggttaagatcaaggttctctgcctcctgaattttgtaacctct
ctccttacttccaggagacattagtcttcagcacaatatcccctcactgaggggctaaaa
tgtgtacacttcaattcctttctaattcttggattgctgaactcctaccagcacctcaga

 1.05 Intr +  12325  12435  111  0  0   36   94    45 0.574   0.48
cctcagtctcccagattgctgggatcacaggcatgagtcactgtgcctggccgcttgtct
ttgactgtccagtctagtacagtgacaaaggacacagtgttagagcaatattgcaaaagc
ctctctactctagtttagtggactacaattttgtgaacaaacaagtgtgctactctccag
AAAATTGTAGAAAAGGACTATTCAGGCAGGTCTCATAATCAGCGTTTCCATGCCGATAAT
ATGGTCAATTCCAAGATTAGGGTCCCGGAAGAGATAGTTAAGATCAACAAG
gtaaatcacagatatccagccatagataagcagatttttaaaatgtccctggattcactc
tttcatgcttcagatttaccacgagatggacaacattgccgcagactttcctgacctggc
gaggagggtgaagattggacattcgtttgaaaaccggccgatgtatgtactgaaggtgag

 1.06 Intr +  12509  12610  102  1  0   60  100   106 0.992   9.37
ttgtagaaaaggactattcaggcaggtctcataatcagcgtttccatgccgataatatgg
tcaattccaagattagggtcccggaagagatagttaagatcaacaaggtaaatcacagat
atccagccatagataagcagatttttaaaatgtccctggattcactctttcatgcttcag
ATTTACCACGAGATGGACAACATTGCCGCAGACTTTCCTGACCTGGCGAGGAGGGTGAAG
ATTGGACATTCGTTTGAAAACCGGCCGATGTATGTACTGAAG
gtgaggccacatgcacttggaagggtctcctgggtcctcatgcccaggacccagcctcag
acctctgaaaagggtagctttttgaactccttgacttcagggaggaaagcgaggtcagga
cacattgtacctgggctggaacttggtctgacagagccccttgcttttgtctaatgtagg

 1.07 Intr +  14818  14928  111  0  0   53   89    69 0.930   4.08
gctcagagggctttgcagagagcagagcctctgagggtggcagggaggcttttgagggtg
gatgctgttctaggagcattcattctagctggttgctgggcatcttgagaagatacatgg
ttcagccctaatggcccatcctgccatgggatagctgacaagcatattgtctctgcttag
ATTGTATCTGATTACCAGAGGGATCCAGCTATCACCTCCATCTTGGAGAAAATGGATATT
TTCTTGTTGCCTGTGGCCAATCCTGATGGATATGTGTATACTCAAACTCAA
gtgagtattcccaaatgggctgggcttgcagactgttgaattccttgctttgccactaat
tgtctgatcttggagagaatttccacaaatgtgcaccttatgagcttccttgggatttca
tcttctagtcatcctcagagctgagaatcaccaggggatatttcttcttagagaaaatag

 1.08 Intr +  16338  16428   91  2  1   85   96    76 0.999   7.67
gggaaatactcctctctctgcaggaggagagacaactgctcaatgaggactaggagcccc
agggccctcctggcagaactgcaagcagcctgccctgcctgcgtgtcatctccaccctag
ccctcttcggtgatctgatctgcctctggttgtttgtcccctccttggtggctttttcag
AACCGATTATGGAGGAAGACGCGGTCCCGAAATCCTGGAAGCTCCTGCATTGGTGCTGAC
CCAAATAGAAACTGGAACGCTAGTTTTGCAG
gtaggcggtggggagacagttctcaaatcctgctgtccctgggctcgcctggtctaccag
tgctctgagctggccgggacggagcgcgtttccactttggttccgttgctgcgtcactga
gagactgaggagcactccttaggctctgacttagtgttttgtttgttgttgctgttttga

 1.09 Intr +  18749  19017  269  0  2  104   80   281 0.819  26.15
aactgctattggtacaaggcaaggtcaactccaacagtttttctcctcagctgtagcaga
cccaacacccaaccctccctcttccatgccttctctgcagtccacacccaccatggacta
ggtgctctgggccgtctcgccatggcctgcccattcccaataccttcggcccctctctag
GTGGAGCGTCTTGCATTTCTGTGTTCTTGGACTATGAGTTAATGTTTGTTCTTGGGCTAT
CCCCAACAGGAAAGGGAGCCAGCGACAACCCTTGCTCCGAAGTGTACCATGGACCCCACG
CCAATTCGGAAGTGGAGGTGAAATCAGTGGTAGATTTCATCCAAAAACATGGGAATTTCA
AGGGCTTCATCGACCTGCACAGCTACTCGCAGCTGCTGATGTATCCATATGGGTACTCAG
TCAAAAAGGCCCCAGATGCCGAGGAACTC
gtgagtcacagctgcctcccacccagcctggggcccgcctgaccctcctggcgctgctaa
ggtggtagctctgcagctttatagggagggtccaggagcctaggcatgtttcattgaagg
tccaatcttctctccctgccctttgggatatgctgtcatctgctggggacaggaaaacag

 1.10 Intr +  20069  20153   85  1  1   79   84    56 0.618   3.69
aaccatgccacctccctcagtttacagttgggccttggcactgggcgaaggggaaacaag
ggaccagaaaggaaatcggggggggctgagaatcttccaaaccatcccagagcagagcag
ctgaggaaggtcaagcttcaggatcgattttttctcactccacggattcccccttcccag
GACAAGGTGGCGAGGCTTGCGGCCAAAGCTCTGGCTTCTGTGTCGGGCACTGAGTACCAA
GTGGGTCCCACCTGCACCACTGTCT
gtaagtactcgcttatttatgagttatttagaaagcactttgagaggaaacttgaaatgg
agtgggaggagggctgtaagttagacttacttgtcatctgattgtttttgttgttggtaa
tagactgaactacatcatgcctgtgtggtgacagctgttgcatgcagtccccttcatcaa

 1.11 Term +  30520  30707  188  2  2   47   48   280 0.691  17.55
gccaatgcaggatgtcctgagacatagggatcaggctgatgattttgtcataggactgat
gacttgaggagcaaactctggattccttaaggaaccccaggcaggcagagctcttggccc
cttcccatctaacccaggagggaactgggcttcaagagtgttttgtcctccgacttacag
ATCCAGCTAGCGGGAGCAGCATCGACTGGGCGTATGACAACGGCATCAAATTTGCATTCA
CATTTGAGTTGAGAGATACCGGGACCTATGGCTTCCTCCTGCCAGCTAACCAGATCATCC
CCACTGCAGAGGAGACGTGGCTGGGGCTGAAGACCATCATGGAGCATGTGCGGGACAACC
TCTACTAG
gcgatggctctgctctgtctacatttatttgtacccacacgtgcacgcactgaggccatt
gttaaaggagctctttcctacctgtgtgagtcagagccctctgggtttgtggagcacaca
ggcctgcccctctccagccagctccctggagtcgtgtgtcctggcggtgtccctgcaaga

Predicted peptide sequence(s):


>CPA4_1|GENSCAN_predicted_peptide_1|446_aa
MRWILFIGALIGSSICGQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSF
NRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNY
GAYHSLEAKIVEKDYSGRSHNQRFHADNMVNSKIRVPEEIVKINKIYHEMDNIAADFPDL
ARRVKIGHSFENRPMYVLKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLW
RKTRSRNPGSSCIGADPNRNWNASFAGGASCISVFLDYELMFVLGLSPTGKGASDNPCSE
VYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVA
RLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPA
NQIIPTAEETWLGLKTIMEHVRDNLY