GENSCAN 1.0	Date run: 16-Jan-104	Time: 21:32:31

Sequence CLDN3_1 : 3648 bp : 61.73% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   1398   2060  663  2  0   91   49  1454 0.961 136.04
gcaggcgcagccgcggcgagagcgtatggagccgagccgttagcgcgcgccgtcggtgag
tcagtccgtccgtccgtccgtccgtcggggcgccgcagctcccgccaggcccagcggccc
cggcccctcgtctccccgcacccggagccacccggtggagcgggccttgccgcggcagcc
ATGTCCATGGGCCTGGAGATCACGGGCACCGCGCTGGCCGTGCTGGGCTGGCTGGGCACC
ATCGTGTGCTGCGCGTTGCCCATGTGGCGCGTGTCGGCCTTCATCGGCAGCAACATCATC
ACGTCGCAGAACATCTGGGAGGGCCTGTGGATGAACTGCGTGGTGCAGAGCACCGGCCAG
ATGCAGTGCAAGGTGTACGACTCGCTGCTGGCACTGCCACAGGACCTTCAGGCGGCCCGC
GCCCTCATCGTGGTGGCCATCCTGCTGGCCGCCTTCGGGCTGCTAGTGGCGCTGGTGGGC
GCCCAGTGCACCAACTGCGTGCAGGACGACACGGCCAAGGCCAAGATCACCATCGTGGCA
GGCGTGCTGTTCCTTCTCGCCGCCCTGCTCACCCTCGTGCCGGTGTCCTGGTCGGCCAAC
ACCATTATCCGGGACTTCTACAACCCCGTGGTGCCCGAGGCGCAGAAGCGCGAGATGGGC
GCGGGCCTGTACGTGGGCTGGGCGGCCGCGGCGCTGCAGCTGCTGGGGGGCGCGCTGCTC
TGCTGCTCGTGTCCCCCACGCGAGAAGAAGTACACGGCCACCAAGGTCGTCTACTCCGCG
CCGCGCTCCACCGGCCCGGGAGCCAGCCTGGGCACAGGCTACGACCGCAAGGACTACGTC
TAA
gggacagacgcagggagaccccaccaccaccaccaccaccaacaccaccaccaccaccgc
gagctggagcgcgcaccaggccatccagcgtgcagccttgcctcggaggccagcccaccc
ccagaagccaggaagcccccgcgctggactggggcagcttccccagcagccacggctttg

Predicted peptide sequence(s):


>CLDN3_1|GENSCAN_predicted_peptide_1|220_aa
MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV