GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:28:12

Sequence CFTR_1 : 191099 bp : 35.97% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 PlyA -    469    464    6                              -0.45
 1.02 Term -    946    593  354  1  0  112   44   285 0.672  20.01
 1.01 Init -  12949  12845  105  1  0   65   84    69 0.435   4.47
 1.00 Prom -  17766  17727   40                              -5.75

 2.04 PlyA -  17802  17797    6                               1.05
 2.03 Term -  18785  18668  118  1  1   90   42   128 0.992   5.43
 2.02 Intr -  35712  35560  153  2  0   66   72   131 0.479   7.57
 2.01 Init -  36445  36231  215  1  2   58   86    65 0.968   1.56
 2.00 Prom -  36523  36484   40                              -3.05

 3.01 Init +  38368  38420   53  0  2   59   36   101 0.477   2.68
tttttcttttttcttttattttttattattatactttaagttgtgtgatacatgtgcaga
atgtgcaggtttgttacataggtatcaacaactctataaaacatgttctatccaggaaaa
gaaactatcatcagagtgaacaggcaacttacggaatgggagaaaatgtttgcaatctag
ATGGCGATTGCAATGGCGGTTCGCTGCATCCATCAGCCCATCATCTACATTAG
gtatttctcctaatgctatccctccccttgctccccaccccctcacaggcccctgtgtgt
gatgttcccctccctgtgtccatgtgttctcattgttcaactcccacttatgagtgagaa
catgtggtgtttggttttctgttcttgtgttagtttgctgagaatgatggtttccagctt

 3.02 Intr +  47280  50111 2832  0  0   86   53   935 0.319  76.19
aattggagcatttagtccatttatatttaaagttaatattgttatgtgtgaatttgatcc
tgtcattatgatgttagctggtgattttgctcattagttgatgcagtttcttcctagtct
cgatggtctttacattttggcatgattttgcagcggctggtactggttgttcctttccag
GTTTAGCGCTTCCTTCAGGAGCTCTTTTAGGGCAGGCCTGGTGGTGACAAAATCTCTCAG
CATTTGCTTGTCTATAAAGTATTTTATTTCTCCTTCACTTATGAAGCTTAGTTTGGCTGG
ATATCTCTCAGACCACAGTGCAATCAAACTAGAACTCAGGATTAAGAATCTCACTCAAAG
CCGCTCAACTACATGGAAACTGAACAACCTGCTCCTGAATGACTACTGGGTACATAACGA
AATGAAGACAGAAATAAAGATGTTCTTTGAAACCAACGAGAACAAAGACACCACATACCA
GAATCTCTGGGATGCATTCAAAGCAGTGTGTAGAGGGAAATTTATAGCACTAAATGCCTA
CAAGAGAAAGCAGGAAAGATCCAAAATTGACACCCTAACATCACAATTAAAAGAACTAGA
AAAGCAAGAGCAAACACATTCAAAAGCTAGCAGAAGGCAAGAAATAACTAAAATCAGAGC
AGAACTGAAGGAAATAGAGACACAAAAAACCCTTCAAAAAATCAATGAATCCAGGAGCTG
GTTTTTTGAAAGGATCAACAAAATTGATAGACCGCTAGCAAGACTAATAAAGAAAAAAAG
AGAGAAGAATCAAATAGACACAATAAAAAATGATAAAGGGGATATCACCACCAATCCCAC
AGAAATACAAACTACCATCAGAGAATACTACAAACACTTCTACGCAAATAAACTAGAAAA
TCTAGAAGAAATGGATACATTCCTCGACACATACACTCTCCCAAGACTAAACCAGGAAGA
AGTTGAATCTCTGAATAGACCAATAACAGGCTCTGAAATTGTGGCAATAATCAATAGTTT
ACCAACCAAAAAGAGTCCAGGACCAGATGGATTCACAGCCGAATTCTACCAGAGGTACAA
GGAGGAACTGGTACCATTCCTTCTGAAACTATTCCAATCAATAGAAAAAGAGGGAATCCT
CCCTAACTCATTTTATGAGGCCAGCATCATTCTGATACCAAAGCCGGGCAGAGACACAAC
CAAAAAAGAGAATTTTAGACCAATATCCTTGATGAACATTGATGCAAAAATCCTCAATAA
AATACTGGCAAACCGAATCCAGCAGCACATCAAAAAGCTTATCCACCATGATCAAGTGGG
CTTCATCCCTGGGATGCAAGGCTGGTTCAATATACGCAAATCAATAAATGTAATCCAGCA
TATAAACAGAGCCAAAGACAAAAACCACATGATTATCTCAATAGATGCAGAAAAAGCCTT
TGACAAAATTCAACAACCCTTCATGCTAAAAACTCTCAATAAATTAGGTATTGATGGGAC
GTATTTCAAAATAATAAGAGCTATCTATGACAAACCCACAGCCAATATCATACTGAATGG
GCAAAAACTGGAAGCATTCCCTTTGAAAACTGGCACAAGACAGGGATGCCCTCTCTCACC
GCTCCTATTCAACATAGTGTTGGAAGTTCTGGCCAGGGCAATCAGGCAGGAGAAGGAAAT
AAAGGGTATTCAATTAGGAAAAGAGGAAGTCAAATTGTCCCTGTTTGCAGACGACATGAT
TGTTTATCTAGAAAACCCCATCGTCTCAGCCCAAAATCTCCTTAAGCTGATAAGCAACTT
CAGCAAAGTCTCAGGATACAAAATCAATGTACAAAAATCACAAGCATTCTTATACACCAA
CAACAGACAAACAGAGAGCCAAATCATGAGTGAACTCCCATTCACAATTGCTTCAAAGAG
AATAAAATACCTAGGAATCCAACTTACAAGGGATGTGAAGGACCTCTTCAAGGAGAACTA
CAAACCACTGCTCAAGGAAATAAAAGAGGACACAAACAAATGGAAGAACATTCCATGCTC
ATGGGTAGGAAGAATCAATATCGTGAAAATGGCCATACTGCCCAAGGTAATTTACAGATT
CAATGCCATCCCCATCAAGCTACCAATGACTTTCTTCATAGAATTGGAAAAAACTACTTT
AAAGTTCATATGGAACCAAAAAAGAGCCCGCATCGCCAAGTCAATCGTAAGCCAAAAGAA
CAAAGCTGGAGGCATCACGCTACCTGACTTCAAACTATACTACAAGGCTACAGTAACCAA
AACAGCATGGTACTGGTACCAAAACAGAGATATAGATCAATGGAACAGAACAGAGCCCTC
AGAAATAACGCCGCATATCTACAACTATCTGATCTTTGACAAACCTGAGAAAAACAAGCA
ATGGGGAAAGGATTCCCTATTTAATAAATGGTGCTGGGAAAACTGGCTAGCCATATGTAG
AAAGCTGAAACTGGATCCCTTCCTTACACCTTATACAAAAATCAATTCAAGATGGATTAA
AGATTTAAACGTTAGACCTAAAACCATAAAAACCCTAGAAGAAAACCTAGGTATTACCAT
TCAGGACATAGGCGTGGGCAAGGACTTCATGTCCAAAACACCAAAAGCAATGGCAACAAA
AGCCAAAATTGACAAATGGGATCTAATTAAACTAAAGAGCTTCTGCAAAGCAAAAGAAAC
TACCATCAGAGTGAACAGGCAACCTACAACATGGGAGAAAATTTTCGCAACCTACTCATC
TGACAAAGGGCTAATATCCAGAATCTACAATGAACTCAAACAAATTTACAAGAAAAAAAC
AAACAACCCCATCAAAAAGTGGGCGAAGGACATGAACAGACACTACTCAAAAGAAGACAT
TTATGCAGCCAAAAAACACATGAAGAAATGCTCATCATCACTGGCCATCAGAGAAATGCA
AATCAAAACCACTATGAGATATCATCTCACACCAGTTAGAATGGCAATCATTAAAAAGTC
AGGAAACAACAG
gtgctggagaggatgtggagaaataggaacacttttacactgttggtgggactgtaaact
agttcaaccattgtggaagtcagtgtggcgattcctcagggatctagaactagaaatacc
atttgacccagccatcccattactgggtatatacccaaaggactataaatcatgctgcta

 3.03 Intr +  57790  57915  126  1  0   36   98    72 0.286   1.87
cacataggaggcatttaccaaacagtagttattatttttgttaccatctatttgataata
aaataatgcccatctgttgaataaaagaaatatgacttaaaaccttgagcagttcttaat
agataatttgacttgtttttactattagattgattgattgattgattgattgatttacag
AGATCAGAGAGCTGGGAAGATCAGTGAAAGACTTGTGATTACCTCAGAAATGATTGAAAA
TATCCAATCTGTTAAGGCATACTGCTGGGAAGAAGCAATGGAAAAAATGATTGAAAACTT
AAGACA
gtaagttgttccaataatttcaatattgttagtaattctgtccttaattttttaaaaata
tgtttatcatggtagacttccacctcatatttgatgtttgtgacaatcaaatgattgcat
ttaagttctgtcaatattcatgcattagttgcacaaattcactttcatgggctgtagttt

 3.04 Intr +  61342  61588  247  1  1   74   95   113 0.883   7.14
actgaggcccagagagattaaataacatgcccaaggtcacacaggtcatatgatgtggag
ccaggttaaaaatataggcagaaagactctagagaccatgctcagatcttccattccaag
atccctgatatttgaaaaataaaataacatcctgaattttattgttattgttttttatag
AACAGAACTGAAACTGACTCGGAAGGCAGCCTATGTGAGATACTTCAATAGCTCAGCCTT
CTTCTTCTCAGGGTTCTTTGTGGTGTTTTTATCTGTGCTTCCCTATGCACTAATCAAAGG
AATCATCCTCCGGAAAATATTCACCACCATCTCATTCTGCATTGTTCTGCGCATGGCGGT
CACTCGGCAATTTCCCTGGGCTGTACAAACATGGTATGACTCTCTTGGAGCAATAAACAA
AATACAG
gtaatgtaccataatgctgcattatatactatgatttaaataatcagtcaatagatcagt
tctaatgaactttgcaaaaatgtgcgaaaagatagaaaaagaaatttccttcactaggaa
gttataaaagttgccagctaatactaggaatgttcaccttaaacttttcctagcatttct

 3.05 Intr +  63258  63350   93  2  0   85   55    60 0.741   1.64
cctagtgcttggcaaattaactttagaacactaataaaattattttattaagaaataatt
actatttcattattaaaattcatatataagatgtagcacaatgagagtataaagtagatg
taataatgcattaatgctattctgattctataatatgtttttgctctcttttataaatag
GATTTCTTACAAAAGCAAGAATATAAGACATTGGAATATAACTTAACGACTACAGAAGTA
GTGATGGAGAATGTAACAGCCTTCTGGGAGGAG
gtcagaatttttaaaaaattgtttgctctaaacacctaactgttttcttctttgtgaata
tggatttcatcctaatggcgaataaaattagaatgatgatataactggtagaactggaag
gaggatcactcacttattttctagattaagaagtagaggaatggccaggtgctcatggtt

 3.06 Intr +  69883  70065  183  0  0   82   63   140 0.988   9.96
ctagaaaccgtatgctatataattatgtactataaagtaataatgtatacagtgtaatgg
atcatgggccatgtgcttttcaaactaattgtacataaaacaagcatctattgaaaatat
ctgacaaactcatcttttatttttgatgtgtgtgtgtgtgtgtgtgtgtttttttaacag
GGATTTGGGGAATTATTTGAGAAAGCAAAACAAAACAATAACAATAGAAAAACTTCTAAT
GGTGATGACAGCCTCTTCTTCAGTAATTTCTCACTTCTTGGTACTCCTGTCCTGAAAGAT
ATTAATTTCAAGATAGAAAGAGGACAGTTGTTGGCGGTTGCTGGATCCACTGGAGCAGGC
AAG
gtagttcttttgttcttcactattaagaacttaatttggtgtccatgtctcttttttttt
ctagtttgtagtgctggaaggtatttttggagaaattcttacatgagcattaggagaatg
tatgggtgtagtgtcttgtataatagaaattgttccactgataatttactctagtttttt

 3.07 Intr +  80705  80896  192  1  0   97   94    98 0.951  10.07
gtatcttttgtgcatagcagagtacctgaaacaggaagtattttaaatattttgaatcaa
atgagttaatagaatctttacaaataagaatatacacttctgcttaggatgataattgga
ggcaagtgaatcctgagcgtgatttgataatgacctaataatgatgggttttatttccag
ACTTCACTTCTAATGGTGATTATGGGAGAACTGGAGCCTTCAGAGGGTAAAATTAAGCAC
AGTGGAAGAATTTCATTCTGTTCTCAGTTTTCCTGGATTATGCCTGGCACCATTAAAGAA
AATATCATCTTTGGTGTTTCCTATGATGAATATAGATACAGAAGCGTCATCAAAGCATGC
CAACTAGAAGAG
gtaagaaactatgtgaaaactttttgattatgcatatgaacccttcacactacccaaatt
atatatttggctccatattcaatcggttagtctacatatatttatgtttcctctatgggt
aagctactgtgaatggatcaattaataaaacacatgacctatgctttaagaagcttgcaa

 3.08 Intr + 108979 109073   95  0  2   80   63   129 0.486   7.44
atgttgtttttgaccaactaaataaattgcatttgaaataatggagatgcaatgttcaaa
atttcaactgtggttaaagcaatagtgtgatatatgattacattagaaggaagatgtgcc
tttcaaattcagattgagcatactaaaagtgactctctaattttctatttttggtaatag
GACATCTCCAAGTTTGCAGAGAAAGACAATATAGTTCTTGGAGAAGGTGGAATCACACTG
AGTGGAGGTCAACGAGCAAGAATTTCTTTAGCAAG
gtgaataactaattattggtctagcaagcatttgctgtaaatgtcattcatgtaaaaaaa
ttacagacatttctctattgctttatattctgtttctggaattgaaaaaatcctggggtt
ttatggctagtgggttaagaatcacatttaagaactataaataatggtatagtatccaga

 3.09 Intr + 111593 111679   87  2  0   89   95    25 0.356   1.47
atagtaaaaacatgtataaaagtgctacttctgcaccacttttgagaatagtgttatttc
agtgaatcgatgtggtgaccatattgtaatgcatgtagtgaactgtttaaggcaaatcat
ctacactagatgaccaggaaatagagaggaaatgtaatttaatttccattttctttttag
AGCAGTATACAAAGATGCTGATTTGTATTTATTAGACTCTCCTTTTGGATACCTAGATGT
TTTAACAGAAAAAGAAATATTTGAAAG
gtatgttctttgaataccttacttataatgctcatgctaaaataaaagaaagacagactg
tcccatcatagattgcattttacctcttgagaaatatgttcaccattgttggtatggcag
aatgtagcatggtattaactcaaatctgatctgccctactgggccaggattcaagattac

 3.10 Intr + 113174 113897  724  2  1   50  100   438 0.346  31.70
atcagaattcacaaggtaccaatttaattactacagagtacttatagaatcatttaaaat
ataataaaattgtatgatagagattatatgcaataaaacattaacaaaatgctaaaatac
gagacatattgcaataaagtatttataaaattgatatttatatgtttttatatcttaaag
CTGTGTCTGTAAACTGATGGCTAACAAAACTAGGATTTTGGTCACTTCTAAAATGGAACA
TTTAAAGAAAGCTGACAAAATATTAATTTTGCATGAAGGTAGCAGCTATTTTTATGGGAC
ATTTTCAGAACTCCAAAATCTACAGCCAGACTTTAGCTCAAAACTCATGGGATGTGATTC
TTTCGACCAATTTAGTGCAGAAAGAAGAAATTCAATCCTAACTGAGACCTTACACCGTTT
CTCATTAGAAGGAGATGCTCCTGTCTCCTGGACAGAAACAAAAAAACAATCTTTTAAACA
GACTGGAGAGTTTGGGGAAAAAAGGAAGAATTCTATTCTCAATCCAATCAACTCTATACG
AAAATTTTCCATTGTGCAAAAGACTCCCTTACAAATGAATGGCATCGAAGAGGATTCTGA
TGAGCCTTTAGAGAGAAGGCTGTCCTTAGTACCAGATTCTGAGCAGGGAGAGGCGATACT
GCCTCGCATCAGCGTGATCAGCACTGGCCCCACGCTTCAGGCACGAAGGAGGCAGTCTGT
CCTGAACCTGATGACACACTCAGTTAACCAAGGTCAGAACATTCACCGAAAGACAACAGC
ATCCACACGAAAAGTGTCACTGGCCCCTCAGGCAAACTTGACTGAACTGGATATATATTC
AAGAAGGTTATCTCAAGAAACTGGCTTGGAAATAAGTGAAGAAATTAACGAAGAAGACTT
AAAG
gtaggtatacatcgcttgggggtatttcaccccacagaatgcaattgagtagaatgcaat
atgtagcatgtaacaaaatttactaaaatcataggattaggataaggtgtatcttaaaac
tcagaaagtatgaagttcattaattatacaagcaacgttaaaatgtaaaataacaaatga

 3.11 Intr + 116170 116298  129  0  0   50   94    35 0.429   0.27
tagacattattctggctatagaatgacatcatacatggcatttataatgatttatatttg
ttaaaatacacttagattcaagtaatactattcttttattttcatatattaaaaataaaa
ccacaatggtggcatgaaactgtactgtcttattgtaatagccataattcttttattcag
GAGTGCTTTTTTGATGATATGGAGAGCATACCAGCAGTGACTACATGGAACACATACCTT
CGATATATTACTGTCCACAAGAGCTTAATTTTTGTGCTAATTTGGTGCTTAGTAATTTTT
CTGGCAGAG
gtaagaatgttctattgtaaagtattactggatttaaagttaaattaagatagtttgggg
atgtatacatatatatgcacacacataaatatgtatatatacacatgtatacatgtataa
gtatgcatatatacacacatatatcactatatgtatatatgtatatattacatatatttg

 3.12 Intr + 117350 117447   98  1  2   -2   55   109 0.641  -3.51
actcaaagcaaatctgtactaaattttgaattcattctgagaggtgacagcatgctggca
gtcctggcagccctcgctcactctcagggcctccttgaccttgacgcccactctggctgt
gcgtgaggagcccttcagccctcccctgcactgtgggagcccctttctgggctggccaag
GCCAGAGCCGGCTCCCTCAGCTTGCGGGGAGGTGTGGAGGGAGAGGCGCTGGGGGAACTG
GGGCTGCGGGTGCCCTTGTGGGCCAGCGCGAGTTCTGG
gtgggtgtgggctgggcaggccccgcactcggagcagccggccggccccgcgagccccag
gcagtgaggggcttagcacctgggccagcagctgctgtactcgatttctcactgggcctt
agctgcctccctgcggggcagggctcgggacctgcagcctgccatgcctgagcctccccc

 3.13 Intr + 117644 117822  179  2  2   81   44   152 0.039   8.74
caggccccgcactcggagcagccggccggccccgcgagccccaggcagtgaggggcttag
cacctgggccagcagctgctgtactcgatttctcactgggccttagctgcctccctgcgg
ggcagggctcgggacctgcagcctgccatgcctgagcctccccccaacctgccgctgcag
TGGGCTCCTGCGTGGCCCAAGCCTCCTGACGAGCACCGCCCCCTGCTCCACGGCACCCAG
TCCCATAGACCGCCCAAGGGCTGAGGAGTGTGGGTGCAGGGCGCAGGGCTGGCAGGCAGC
TCCACCTGCAGCCCCAGTGCGGGATCCACTGGGTGAAGCCAGCTGGGCTTCTGAGTCTG
gtggggacttggaggatctttatgtctagctaagggattgtaaatacaccaatcagcact
ctgtatctagctcaaggtttgtaaacacaccaatcagcaccctgtgtctagctcagggtt
tgtgaatgcaccaatcagcactctgtatctagttaatctggtggagacttggagaacctt

 3.14 Intr + 127915 127994   80  2  2   55   91    57 0.810   1.05
acataattatttagaatgtttggaaagaaacaaaaatttctaagtctatctgattctatt
tgctaattcttatttgggttctgaatgcgtctactgtgatccaaacttagtattgaatat
attgatatatctttaaaaaattagtgttttttgaggaatttgtcatcttgtatattatag
GTGGGATTCTTAATAGATTCTCCAAAGATATAGCAATTTTGGATGACCTTCTGCCTCTTA
CCATATTTGACTTCATCCAG
gtatgtaaaaataagtaccgttaagtatgtctgtattattaaaaaaacaataacaaaagc
aaatgtgattttgttttcattttttatttgattgagggttgaagtcctgtctattgcatt
aattttgtaattatccaaagccttcaaaatagacataagtttagtaaattcaataataag

 3.15 Intr + 131760 131910  151  2  1   81   86   121 0.696  10.01
aactaacctgcacaatgtgcacatgtaccctaaaacttaaagtataataaaaaaaataaa
aaaaagtttgaggtgtttaaagtatgcaaaaaaaaaaaaagaaataaatcactgacacac
tttgtccactttgcaatgtgaaaatgtttactcaccaacatgttttctttgatcttacag
TTGTTATTAATTGTGATTGGAGCTATAGCAGTTGTCGCAGTTTTACAACCCTACATCTTT
GTTGCAACAGTGCCAGTGATAGTGGCTTTTATTATGTTGAGAGCATATTTCCTCCAAACC
TCACAGCAACTCAAACAACTGGAATCTGAAG
gtatgacagtgaatgtgcgatactcatcttgtaaaaaagctataagagctatttgagatt
ctttattgttaatctacttaaaaaaaattctgcttttaaacttttacatcatataacaat
aatttttttctacatgcatgtgtatataaaaggaaactatattacaaagtacacatggat

 3.16 Intr + 135854 135954  101  0  2   83  111    28 0.586   3.51
tgcagagcattattctattagtagatgctgtgatgaactgagatttaaaaattgttaaaa
ttagcataaaattgaaatgtaaatttaatgtgatatgtgccctaggagaagtgtgaataa
agtcgttcacagaagagagaaataacatgaggttcatttacgtcttttgtgcatctatag
GAGAAGGAGAAGGAAGAGTTGGTATTATCCTGACTTTAGCCATGAATATCATGAGTACAT
TGCAGTGGGCTGTAAACTCCAGCATAGATGTGGATAGCTTG
gtaagtcttatcatctttttaacttttatgaaaaaaattcagacaagtaacaaagtatga
gtaatagcatgaggaagaactatataccgtatattgagcttaagaaataaaacattacag
ataaattgagggtcactgtgtatctgtcattaaatccttatctcttctttccttctcata

 3.17 Intr + 148764 149012  249  2  0   75   76    79 0.086   2.11
ttcagttaaacttttaattatatccaattatttcctgttagttcattgaaaagcccgaca
aataaccaagtgacaaatagcaagtgttgcattttacaagttattttttaggaagcatca
aactaattgtgaaattgtctgccattcttaaaaacaaaaatgttgttatttttatttcag
ATGCGATCTGTGAGCCGAGTCTTTAAGTTCATTGACATGCCAACAGAAGGTAAACCTACC
AAGTCAACCAAACCATACAAGAATGGCCAACTCTCGAAAGTTATGATTATTGAGAATTCA
CACGTGAAGAAAGATGACATCTGGCCCTCAGGGGGCCAAATGACTGTCAAAGATCTCACA
GCAAAATACACAGAAGGTGGAAATGCCATATTAGAGAACATTTCCTTCTCAATAAGTCCT
GGCCAGAGG
gtgagatttgaacactgcttgctttgttagactgtgttcagtaagtgaatcccagtagcc
tgaagcaatgtgttagcagaatctatttgtaacattattattgtacagtagaatcaatat
taaacacacatgttttattatatggagtcattatttttaatatgaaatttaatttgcaga

 3.18 Intr + 163680 163835  156  2  0   69   99    55 0.399   3.99
atatatcaacattggtcaggattgaaagtgtgcaacaaggtttgaatgaataagtgaaaa
tcttccactggtgacaggataaaatattccaatggtttttattgaagtacaatactgaat
tatgtttatggcatggtacctatatgtcacagaagtgatcccatcacttttaccttatag
GTGGGCCTCTTGGGAAGAACTGGATCAGGGAAGAGTACTTTGTTATCAGCTTTTTTGAGA
CTACTGAACACTGAAGGAGAAATCCAGATCGATGGTGTGTCTTGGGATTCAATAACTTTG
CAACAGTGGAGGAAAGCCTTTGGAGTGATACCACAG
gtgagcaaaaggacttagccagaaaaaaggcaactaaattatattttttactgctatttg
atacttgtactcaagaaattcatattactctgcaaaatatatttgttatgcattgctgtc
ttttttctccagtgcagttttctcataggcagaaaagatgtctctaaaagtttggaattc

 3.19 Intr + 165980 166069   90  1  0   94   50    51 0.007   1.17
tctgtatcaatggatcatttgttttcagacatatgaaacaggaactttgaacaagaaatt
tcccctctttttctcatagtgatcctgagacatcagctgtggaatcacaacacgtcatta
gttttggcaggtccttgcaggtgttttgttttgttttattaatgttcttccctcctgtag
CTAGACAGCAATCTTGGAGAATCTGCCAGCTTGGAAGACTATTGTGTAAATTTCAAGGTG
GAGCCTCCTTTAATTTGTTCTGTGTTACCT
gtgagctgtgaggtcatgaagaggagacaatgaggctaatcatgagagccccattggttt
aggcaattagaacaacaagatctaaaatggtttattagccttgaattgtgttaagcacat
aattcataaaaaacagaaaaaatatttttaaatgtatgtctaaatcttcagttacaagtt

 3.20 Intr + 174083 174172   90  1  0   91   94    19 0.089   2.07
gaatgatacaaagcagacatgataaaatattaaaatttgagagaacttgatggtaagtac
atgggtgtttcttattttaaaataatttttctacttgaaatattttacaatacaataagg
gaaaaataaaaagttatttaagttattcatactttcttcttcttttcttttttgctatag
AAAGTATTTATTTTTTCTGGAACATTTAGAAAAAACTTGGATCCCTATGAACAGTGGAGT
GATCAAGAAATATGGAAAGTTGCAGATGAG
gtaaggctgctaactgaaatgattttgaaaggggtaactcataccaacacaaatggctga
tatagctgacatcattctacacactttgtgtgcatgtatgtgtgtgcacaactttaaaat
ggagtaccctaacatacctggagcaacaggtacttttgactggacctacccctaactgaa

 3.21 Intr + 175285 175370   86  0  2   79   62    25 0.045  -3.30
tccaactatgaaattgtgaaatcaaacctattatgtactttcaaaataaaatggtgaaac
aggcacaggctagacagtcccatttcaaaaaagagaaatagaaaagaaaaaaggagtgac
aggtctctataagtctaaaactttaaggcttgagaataatttgctttgctttgcctccag
GCTCACTGGGGTGGTGTCTTACCTCTGGACACACTGGGGTGGAGGCTCTATCCTCATGGA
TTTGAGTGTCTCATTCTTTGTGGCAG
gtctgtgctccaatcccacacctatggctccctgagtgtgcaattgcatgcctggtggtt
ctactggtctgggattgcataggtggcccagccttcatagctccactgggcattgcccta
atgtgggctctatgtggtgacctcacccctgggcctctacctgggccctgtgactccctg

 3.22 Intr + 180776 180926  151  2  1   50   26   175 0.380   6.74
ggtcagggattatatcctattaattgttgtatttccagtgcctagagtagtcttgcatac
atggatggtattcaataaatattggttgaatgaataaggagttctttcatttcatatgta
atagatcatggaaatagccttgtgattgatacacagcaggtattaccatcctcactttag
AATGAGGACTCAGAGCCTTGAGATGTCTGAGGGCCTTGACTGGGACAGCTGGCAGATGCA
GGAGCAGAGCTGCATCACCCCTGTGGGCTATCTCAGGGTTGTCTGTAATCTAAGTACAAT
GTCTGTTGATTTTGGACTGAAGGCTTTTTGG
gtaattgtttgctttttcaatacttataaaatagtttccatccttactcattgatagtaa
ggttagttattttagaaaacaagctaaatagcagaaatagtggccttttaagttgaaaat
ttaccctgaaaaatctacagagtagcaaacagagtatcaaaaggagttgactgtatctat

 3.23 Intr + 185927 186099  173  1  2   96   65   126 0.999   8.92
tgagctgtcaaggttgtaaatagacttttgctcaatcaattcaaatggtggcaggtagtg
ggggtagagggattggtatgaaaaacataagctttcagaactcctgtgtttatttttaga
atgtcaactgcttgagtgtttttaactctgtggtatctgaactatcttctctaactgcag
GTTGGGCTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGTGGAT
GGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTGGCTAGATCTGTTCTC
AGTAAGGCGAAGATCTTGCTGCTTGATGAACCCAGTGCTCATTTGGATCCAGT
gtgagtttcagatgttctgttacttaatagcacagtgggaacagaatcattatgcctgct
tcatggtgacacatatttctattaggctgtcatgtctgcgtgtgggggtctcccccaaga
tatgaaataattgcccagtggaaatgagcataaatgcatatttccttgctaagagtcttg

 3.24 Intr + 186698 186803  106  2  1  115   97    36 0.999   6.50
ttagagtctaccccatggttgaaaagctgattgtggctaacgctatatcaacattatgtg
aaaagaacttaaagaaataagtaatttaaagagataatagaacaatagacatattatcaa
ggtaaatacagatcattactgttctgtgatattatgtgtggtattttctttcttttctag
AACATACCAAATAATTAGAAGAACTCTAAAACAAGCATTTGCTGATTGCACAGTAATTCT
CTGTGAACACAGGATAGAAGCAATGCTGGAATGCCAACAATTTTTG
gtgagtctttataactttacttaagatctcattgcccttgtaattcttgataacaatctc
acatgtgatagttcctgcaaattgcaacaatgtacaagttcttttcaaaaatatgtatca
tacagccatccagctttactcaaaatagctgcacaagtttttcactttgatctgagccat

 3.25 Term + 188147 188347  201  1  0   50   44   296 0.855  17.81
aacctccttagagcaaaaggacacagcagttaaatgtgacatacctgattgttcaaaatg
caaggctctggacattgcattctttgacttttattttcctttgagcctgtgccagtttct
gtccctgctctggtctgacctgccttctgtcccagatctcactaacagccatttccctag
GTCATAGAAGAGAACAAAGTGCGGCAGTACGATTCCATCCAGAAACTGCTGAACGAGAGG
AGCCTCTTCCGGCAAGCCATCAGCCCCTCCGACAGGGTGAAGCTCTTTCCCCACCGGAAC
TCAAGCAAGTGCAAGTCTAAGCCCCAGATTGCTGCTCTGAAAGAGGAGACAGAAGAAGAG
GTGCAAGATACAAGGCTTTAG
agagcagcataaatgttgacatgggacatttgctcatggaattggagctcgtgggacagt
cacctcatggaattggagctcgtggaacagttacctctgcctcagaaaacaaggatgaat
taagtttttttttaaaaaagaaacatttggtaaggggaattgaggacactgatatgggtc

Predicted peptide sequence(s):


>CFTR_1|GENSCAN_predicted_peptide_1|152_aa
MTGVLILIVKKFGHRDRLTGRMPCEDENRDQGDASVRVLTAQHQAHPAGGRQSRPLFRSS
WQRWRTEEATGGRTGSPESFLDPPSRQGPPDPGPAATSFPGACLPPPPPFPDDPSRVPVT
FARCILKREGKCAFRISKYSLREPKSSAAVWV

>CFTR_1|GENSCAN_predicted_peptide_2|161_aa
MPKAIAKKAKIDKLDLIKLKSFCTAKEPIIRVNRQPTKWEKIFAIYPSDKDLISRIYKAL
KQIHKKKKTLLRDVDEAGNYHPQQINTGTENQTPCVLTRKRELNIENRWTQRGEQHTPGP
VGNDIALEKALKISQLQFLLEIITTMTTIPDVHESQIQCCL

>CFTR_1|GENSCAN_predicted_peptide_3|2223_aa
MAIAMAVRCIHQPIIYIRFSASFRSSFRAGLVVTKSLSICLSIKYFISPSLMKLSLAGYL
SDHSAIKLELRIKNLTQSRSTTWKLNNLLLNDYWVHNEMKTEIKMFFETNENKDTTYQNL
WDAFKAVCRGKFIALNAYKRKQERSKIDTLTSQLKELEKQEQTHSKASRRQEITKIRAEL
KEIETQKTLQKINESRSWFFERINKIDRPLARLIKKKREKNQIDTIKNDKGDITTNPTEI
QTTIREYYKHFYANKLENLEEMDTFLDTYTLPRLNQEEVESLNRPITGSEIVAIINSLPT
KKSPGPDGFTAEFYQRYKEELVPFLLKLFQSIEKEGILPNSFYEASIILIPKPGRDTTKK
ENFRPISLMNIDAKILNKILANRIQQHIKKLIHHDQVGFIPGMQGWFNIRKSINVIQHIN
RAKDKNHMIISIDAEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDKPTANIILNGQK
LEAFPLKTGTRQGCPLSPLLFNIVLEVLARAIRQEKEIKGIQLGKEEVKLSLFADDMIVY
LENPIVSAQNLLKLISNFSKVSGYKINVQKSQAFLYTNNRQTESQIMSELPFTIASKRIK
YLGIQLTRDVKDLFKENYKPLLKEIKEDTNKWKNIPCSWVGRINIVKMAILPKVIYRFNA
IPIKLPMTFFIELEKTTLKFIWNQKRARIAKSIVSQKNKAGGITLPDFKLYYKATVTKTA
WYWYQNRDIDQWNRTEPSEITPHIYNYLIFDKPEKNKQWGKDSLFNKWCWENWLAICRKL
KLDPFLTPYTKINSRWIKDLNVRPKTIKTLEENLGITIQDIGVGKDFMSKTPKAMATKAK
IDKWDLIKLKSFCKAKETTIRVNRQPTTWEKIFATYSSDKGLISRIYNELKQIYKKKTNN
PIKKWAKDMNRHYSKEDIYAAKKHMKKCSSSLAIREMQIKTTMRYHLTPVRMAIIKKSGN
NRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAAYVRYFN
SSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLG
AINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDD
SLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSG
RISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI
TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK
MEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETL
HRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQMNGIEE
DSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRK
TTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESIPAVTTW
NTYLRYITVHKSLIFVLIWCLVIFLAEARAGSLSLRGGVEGEALGELGLRVPLWASASSG
GLLRGPSLLTSTAPCSTAPSPIDRPRAEECGCRAQGWQAAPPAAPVRDPLGEASWASESG
GILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLR
AYFLQTSQQLKQLESEGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKF
IDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAI
LENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAF
GVIPQLDSNLGESASLEDYCVNFKVEPPLICSVLPKVFIFSGTFRKNLDPYEQWSDQEIW
KVADEAHWGGVLPLDTLGWRLYPHGFECLILCGRMRTQSLEMSEGLDWDSWQMQEQSCIT
PVGYLRVVCNLSTMSVDFGLKAFWVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLA
RSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIE
ENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQD
TRL