GENSCAN 1.0	Date run: 16-Jan-104	Time: 21:40:30

Sequence CCL26_1 : 5132 bp : 47.93% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1281   1353   73  2  1   80   75   157 0.890  12.83
ctgtctaatttcattcctatgagtattagtttacttttcctttgttgggtcaaaagtgct
gcttctgttcccaaccacagaattctctggaattgttttcagggccgtctcagtctcata
aaaggggatcaggcaggaggagtttgggagaaacctgagaagggcctgatttgcagcatc
ATGATGGGCCTCTCCTTGGCCTCTGCTGTGCTCCTGGCCTCCCTCCTGAGTCTCCACCTT
GGAACTGCCACAC
gtacgtagctggcccattcccctcctggggttccttcccggaccgcctgggagtggatgg
aaatgagtatctccaaacccttcctctccctgatttttaggtgggagtgacatatccaag
acctgctgcttccaatacagccacaagccccttccctggacctgggtgcgaagctatgaa

 1.02 Term +   1454   1572  119  0  2   94   48    83 0.940   3.60
cagcatcatgatgggcctctccttggcctctgctgtgctcctggcctccctcctgagtct
ccaccttggaactgccacacgtacgtagctggcccattcccctcctggggttccttcccg
gaccgcctgggagtggatggaaatgagtatctccaaacccttcctctccctgatttttag
GTGGGAGTGACATATCCAAGACCTGCTGCTTCCAATACAGCCACAAGCCCCTTCCCTGGA
CCTGGGTGCGAAGCTATGAATTCACCAGTAACAGCTGCTCCCAGCGGGCTGTGATGTGA
gtatttctcggacgtactttctggggccccatcagtcatgcaacaggatgggtgctgggc
agacccccaggatgagccttgggatgggaacctggaaaccccacctctgcacactaacaa
gtgtgactctgagcttcaggtagaacctgactttttttttctctttttgagacggagttt

Predicted peptide sequence(s):


>CCL26_1|GENSCAN_predicted_peptide_1|63_aa
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQR
AVM