GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:34:22

Sequence CALU_1 : 34491 bp : 40.18% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1067   1251  185  1  2   52  115   341 0.506  29.84
gccacacggccgcgcccacgccacccgcagtacggggctggggctggggctggggctgga
gcccgccgtcccaacaatcccggggacgagagttgggcgggaatccgctccacgcaactc
ggcgcggtcccggggacgtggcgctttccagccaatcccggctatgcgattgttagacca
ATGGCTACTCGGGGACGCTATGCGACAGCGGCGGGTTTGCTGATGATTGGTCGGGAGGCC
GCCGGCGAGGCGGATGAGGGCGGGGTGCGGACCCGCTTCCGGTTGGGCGGTGCTTGCGCG
CGTGAGCTGAGCCGGTGGGTGAGCGGCGGCCACGGCATCCTGTGCTGTGGGGGCTACGAG
GAAAG
gtaagtacggtgatgcccagccccttcaccactgcctcatctttattcgctttctttctg
tccccggtcttgttcttggcgcggcaggggactgcctcactcggtgccgctgtctctgct
ggcgcccgggtcccaggcctgatgctgctggagatcccgggaccctctgtgtgcagcctg

 1.02 Intr +   1388   1479   92  2  2   56   14    60 0.102  -5.88
agcggcggccacggcatcctgtgctgtgggggctacgaggaaaggtaagtacggtgatgc
ccagccccttcaccactgcctcatctttattcgctttctttctgtccccggtcttgttct
tggcgcggcaggggactgcctcactcggtgccgctgtctctgctggcgcccgggtcccag
GCCTGATGCTGCTGGAGATCCCGGGACCCTCTGTGTGCAGCCTGGGATGGAGGCCGCCGC
CCGTCTTACCGCGCGCTCTGGGAAGGGGGCTG
gtccggtggaactctgtcccgttgggtactgttctgtgcctggtttgctgcgtcctggtc
ctccatctctaggtcacgccactcaccgagtctctggcaccagagggtcattttttgcct
ccggaaggtcggagggcatttggatagtgttattgtaagagttccttgccgcctccactc

 1.03 Intr +  10392  10623  232  1  1   88   82   308 0.540  26.11
gaagagtctgatattccaccatacttattttatggatgaagtaatatttgggataatata
aaagacttgcatagatatgtatatcaaattaatagtttaactcggatgtgagcttttaat
ttcttatttagttattaagcatactgcctcctgaattaactgcttttcattttcttcaag
ATCTAATTATCATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTG
CCTTGAGCAAACCCACAGAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACA
AGGTTCACAATGATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAG
AAGCAAAGACCTTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGG
gtaaggtaccacctctcaggggtctagtgtgggtaatgacattctttataaaggctaatt
cttttcttttctggctcagttatgagtaaagttatattgaactattaatacatcttctga
aagctaaccatggaattactacctctaaaatttcattaaatgcctgatttcatacatttt

 1.04 Intr +  16080  16277  198  0  0   65    0   239 0.449  10.34
ccttattcacgtggcttattacagaccagtaatggaccatttttttcagttgctggcctg
gcagttttgttttggagacaattttttatttctgtgcattagccctgggcacacacctgg
ctaagtccagagttctgtgtctttttaaccttttgctggatttctctgcattttctacag
AAAGATTGTAAGTAAAATAGATGGCGACAAGGACGGGTTTGTCACTGTGGATGAGCTCAA
AGACTGGATTAAATTTGCACAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAGTGGAA
GGGGCATGACCTCAATGAGGACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTA
CGGCTACGTTTTAGGTAG
gtccctactgtctgggggaaaaagccttgtggagctggcaccttgaaacgtaactgtttt
gtcttgtagaatgattgtagataaaatagacgcggataaagatgggtttgtgacggaggg
ggagctgaaatcctggattaagcacgcccagaagaaatacatatatgacaatgttgaaaa

 1.05 Intr +  16347  16540  194  0  2   86   82   114 0.455   8.81
ctggatttacgaggatgtagagcgacagtggaaggggcatgacctcaatgaggacggcct
cgtttcctgggaggagtataaaaatgccacctacggctacgttttaggtaggtccctact
gtctgggggaaaaagccttgtggagctggcaccttgaaacgtaactgttttgtcttgtag
AATGATTGTAGATAAAATAGACGCGGATAAAGATGGGTTTGTGACGGAGGGGGAGCTGAA
ATCCTGGATTAAGCACGCCCAGAAGAAATACATATATGACAATGTTGAAAACCAATGGCA
GGAGTTTGATATGAATCAAGACGGCTTAATCTCCTGGGATGAGTACAGAAACGTGACTTA
TGGCACTTACCTGG
gtaaggggcaagatgtcagcctggcagggaccgtggtcttgagtcaaagaaacaaatggg
tcacacagtaaaggaaaggaagcttatcttaaatagttcaattcagtgctaagctgattc
cctttattaattttaaatttgtatattatgtatttttaaatttgtttaatttttgttttc

 1.06 Intr +  20689  20855  167  2  2   84   94   253 0.998  24.26
tctgatgcctggagctgtagcccaaaactaaatgtctttgtactgctgcagttttacctg
tgtcatcaattatttcttccttgcatggttttatctttattggaaattgatttcccaccc
cacacattttcatgttttctgaaagtcttttaagatttgacctaaatttttgttttctag
ATGATCCAGATCCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGA
GGTTTAAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTT
TCCTGCACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAG
gtgggtgagatgaaggattctgaacagggactcagtttctctttttgtggcttattctgt
ctttcccctttagccttatatagcatatcttatatatatatatgctatatagcatatcac
tgtatatgctatataagtattggccagattcagaatccaaggtctgtcactgtttttctg

 1.07 Intr +  21610  21670   61  0  1   98  111    83 0.999   8.99
atttcttggctagaaatggttttaaccatacagacacacatgcatacatacatacataca
tacatacatgtacaagtgtgtttaatgaataataaatgtttacctaaactagatacttta
ctttcttctggcaaattcagagaccaacttaatagtctcttcttattctttcctgtttag
GAAACAATGGAAGATATAGATAAGAATGCTGATGGTTTCATTGATCTAGAAGAGTATATT
G
gtaagtctctgcttttagtgtttttcttagaaaagctgagaagctttgaaaggtgtattt
gctggctgggcacagtggctcatgcctgtaatcccaacactgggaggccgaggcgggcag
atcacctgaggtcaggagtccaagtccagcctggccaacatggggaaaccccgtctctac

 1.08 Intr +  29274  29473  200  1  2   81  115   178 0.848  17.95
taagtgattaagcctcaggaaaataccttgctttctaaggtctgtctggcctaaaatacc
cttgtagctgctgttgggttccaaacaaatggatgaggaaaaagggttaggccagattag
catgaggcagttttggggaaaagacaaacccttcttttgtatgtatgtctgtgtacccag
GTGACATGTACAGCCATGATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAG
AGCAGTTTGTTGAGTTTCGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCA
AAGACTGGATCCTTCCCTCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCT
ATGAATCAGACCAAAACAAG
gtaagtctggcgaggcccacacgctctatccttgattgaagtatgcttctaggggatcac
ctgaacagtttctgttaaggtgcatagagcatttaaggtcttaattagtctaagtcagcc
aagtatctgaatctggcgattaaaacctttcagggcagcactagctatctgatctcattt

 1.09 Term +  30881  30985  105  1  0   91   49   108 0.970   4.63
ttgctgttttcttccctcttcgtatgtatgtagggggaatgagggctgagtagttcacac
ttaatttagtagaaatgagaatcttaacttctgattaaccccaattcttctataacagtg
tttctgaatttttaatgggaaatatgttcttcttcaattcattgctatctctactttcag
GATGGCAAGCTTACCAAGGAGGAGATCGTTGACAAGTATGACTTATTTGTTGGCAGCCAG
GCCACAGATTTTGGGGAGGCCTTAGTACGGCATGATGAGTTCTGA
gctacggaggaaccctcatttcctcaaaagtaatttatttttacagcttctggtttcaca
tgaaattgtttgcgctactgagactgttactacaaactttttaagacatgaaaaggcgta
atgaaaaccatcccgtccccattcctcctcctctctgagggactggagggaagccgtgct

Predicted peptide sequence(s):


>CALU_1|GENSCAN_predicted_peptide_1|477_aa
MATRGRYATAAGLLMIGREAAGEADEGGVRTRFRLGGACARELSRWVSGGHGILCCGGYE
ERPDAAGDPGTLCVQPGMEAAARLTARSGKGADLIIMDLRQFLMCLSLCTAFALSKPTEK
KDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDK
DGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLGRMIVD
KIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYL
DDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETME
DIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWI
LPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF