GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:44:35

Sequence CALD1_1 : 192088 bp : 39.83% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.05 PlyA -    471    466    6                               1.05
 1.04 Term -    986    878  109  1  1   77   43    78 0.044  -0.80
 1.03 Intr -   4490   4340  151  0  1   71   82   133 0.038   9.30
 1.02 Intr -   6470   6370  101  1  2   70  -10    91 0.017  -3.67
 1.01 Init -  15589  15519   71  1  2   89   69    53 0.336   4.07
 1.00 Prom -  16904  16865   40                              -3.55

 2.04 PlyA -  18140  18135    6                               1.05
 2.03 Term -  40717  40527  191  2  2   57   44   166 0.492   5.73
 2.02 Intr -  46067  45985   83  1  2   39   37   197 0.923   8.06
 2.01 Init -  47897  47830   68  2  2   92   92    76 0.992   9.00
 2.00 Prom -  49445  49406   40                              -4.75

 3.01 Init +  57968  58150  183  1  0   73   86   166 0.776  14.06
catgagggttctaatcttcatagttgcttctgtttgataagttctatttatttaggaagc
catacacaggaacacaggcagaagagaaccagaagactgcatccattggaaaatttaata
tacataaaaattaagtgcaccatttcttatcacttgctgaaacttaggtaacttaacatc
ATGCCTTACAAACAACAGTCAGTGCTCGTTGATAATGATGACAGTGGTAGTGGCAGTGGT
GATGATTACGATGATGAAGGCAAGAGAAACAACTGCCACTACCTTTTCACAAACTTTGGA
CTTTTTATTATCTACACTAGGTCTTTCGTGATGAGTGGTAGTTATACCCAGCTCAAACTT
CAG
gtacactatgactctgtgaagagaaagatacatttttctcagtgtctctcatgcctgtag
ccacgggaaacttatcaaacactgacgtcagctactttcccatgagaagttcagaaattt
cataagaccgcaaacgactttctctttcctatttgcttcagacaagtacagaacttttca

 3.02 Intr +  63628  63773  146  0  2   62   64    63 0.002  -0.54
agggctctgcctggaacatgcttccttcagatctttacatgggggggcttcttcctagaa
atgtgtttttagcctagatgtctccttttcagagagactatccctcaccatccaacctcc
agggaccctcagtggacctctttacatcctgctgttttttatttgctcactcactatcag
AAATGTATGGTGTCTGAACTCCAGCAGAGTATAAGCTCCATGGAAGCAGAGCCCTTGTAC
ATCACCTTGTGCTGTGTCCTGAAGCAGAGGACTCACTCAGTGAACAAGCAAGTGGGCTCC
TGTATCCACCAAATACACCCAGCATG
gtgggtcaggccctggctttgaatactggcctcaccactagctgggtgaattcaggcaaa
tgacttcagccaagaaacttctcagtgcttatcctaagataagaatatgtattttacaag
gttgttacagtcatcaaatgaaataatgtgtgcaatgtgcttagcacagggcctaccact

 3.03 Intr +  73786  73901  116  1  2  -26   87   129 0.001   0.57
ggccttgacactgagcagcttcagacttggtcaagagaaagtgatggtacaaaacatttg
aacagcaaggccatatagtattgatcaccaagaacaaggccaataattgctgtagaagct
gaaagggagggtggttctgggataaagataggacttgagctggactctagaaaaatatag
GGGATTTGCAGGAGTGGAGGGCACTTCAGGTTATGGGCAGCAAGAAGCCAGAGACAAAGG
CCCAGAGGCAGAAATGAGGGTGAAATTATTGCAGGATTCAGGAGTTTGGCTTGGCT
gtaagttgtgtttgcatgggagggtagggtggggagaggaatcatgtgatggatagagtg
gagccatttcacagtgagtttctgggttctgcagagaaacaagatggtggtatgtgggag
gaagatcatttttcctgaataactccattcaaaaccaaggaatttgcacctcccaatcac

 3.04 Intr +  76718  76884  167  0  2   13   40   151 0.012   1.56
cccactctttcttcctcctactcccgccatgtcaggcatgcctgcttcctgtttgccttc
cactatgattgaaagtctcctgaggcctccccagccatgttactcatacagcctgcagaa
tcatgatccaattaaagtcttttctttataaattacacagtctcagatggttctttatag
CAGTGCAAGAGCAGACTAATGCACAGTGCAAGGATCTAGGGTCAGAAAGGTGTTTTGGTG
CTCAACAGACCTATGGCTTAATGTCCACGTTCACTTGTCCAGTGGTCAATGCAGATCTTT
CTGGTGATCAAGCACAATATGAATACTCTCACTTGAGGGGTACGAAG
gtggattcatttgctccatttttctttggcttcctgtgtagatggaattgaaatgggaat
gatatgtgcattccaaaggatctcaagagaaatgctcattcgtttacaagaggtgcaatc
ccacaatagtttcttgctttgtatacttgaaaacattcccaaagaaacaaagttggatgc

 3.05 Intr +  89249  89360  112  1  1  135  116    87 0.738  15.23
tgaatgagactgaatttaactcggctcaggagtcagaaattgatcactggctaccttatc
agctttctaagagtaaagaaaaatcaggagaatgacaaatgggaaagagggcccatagta
actcaggagaagtaacacactgagttatcaatgatattgactctacctcctctctttcag
GTCCAGACATCATCTGGTCTCCCTGAACCTGAAATCACACCATGGATGATTTTGAGCGTC
GCAGAGAACTTAGAAGGCAAAAGAGGGAGGAGATGCGACTCGAAGCAGAAAG
gtaaggatctagggtgaaaaatacttgtattcccttattaacaaccttggtttcaggcct
caaagaccatccttttgagaggccaaatgtggtcatatcgcacaccaaactgttcgcaaa
agtagttatggaaaatttttctgctaagactctaaattaagcatttaaaaaaggaaaaca

 3.06 Intr + 109516 109609   94  2  1   92   27    81 0.336   0.50
gtgtgcatgtgtatgtgtgcgcatgtgtatgtgtgtgcatgtgtgcatatgcatgcattc
gtgtatgtgtgtgtgcctgtgtgtgcatgtgtgtctgtatgtgtgtgtatgtgtgtgcat
gtgtgtcataagcgcattagggcgtatgcacagcacttcccacatacctctcttccctag
GGAATTGTTTCAAGGTAGAAGCTGTTCTTAAACAACTGCTGCAGACTCTAAAGTCTGGAA
CAGATCTTGTGGTCCGGTCTCCCACCTCCATGAA
gtaaagttatttttaaaaaatcatattttcttaataaaggaccaccctgtggtgggagct
gttcctttctattacagtctgacctccctcaaaccttcccagcccagaatctctttgatg
aaaaattaaacaataaagtgtccagaaacaaaggatactatgagtaatctcagaatggcc

 3.07 Intr + 110066 110273  208  2  1   90   69    61 0.294   2.56
gccaatgaatagtcattagttcacttctcagagacaccagttctggcagctggacactgg
gtaccattctctgctatgcagtgaaagcacacaggcctgtaggtctctgcaggaccagaa
cactgtgcacaaataacctttagattgttatttctcaatcctcttaccttgcctctccag
CCCCAGGCACCAGGTCTCAGAGGACTCTTGGAAGCACTTGCCTAGCCCAGCCCTGCTCTC
AGCTCATGATTCACTTGTTATCTCTATGCGTCTTCCCGCGTTGCCTGTCTTTCATTGGCC
TTTGTGTTCTTCCTCTTCCCAGAGAGTGTCTGAACCAGGTCCAAGACTCACTTCTCTCTT
CACTCTTCCCATGTCAGTACCCTACCAG
gtagcatgagctataacaccactgggttttactatcacaaactgaagacagacagctgct
tcccaaatgcatgcccctaataacaaaggagggtgcgcgctgtttccctttccctctttt
ggcaattagggaaatagcctggtggacatcctgtgtacagctggcaattagcacactttc

 3.08 Intr + 113842 113991  150  0  0   47   81    62 0.277   0.84
agccaaagccctcaatatactgaccatctgactaagacagaacaagacccagagcatatg
ctattgatcagggaattgttcagataacggactccaagggtttaggatcatgaaatcctg
gaatgttaaagccagaagggaggcctttagactctttggtgcaatgctgtctttcaatag
GCAGGGAAACAGAAACCAGAGGGGCAACTCAACTTACCCCAAAGCAGACAACAGTCGGTA
GCAAAGCCATGTCTTTGTACTCTCATGCAAAGGGCCGTTTTCACACTGGTGTTTATGAGG
TTTGAAAAACTTACTGGGTCTTGGGAAAAG
gtaccgcacaagaattagaacaccaaatggcctttcagtaaatcttttccatttttgaga
gttttggcaccgattcagcatgacaattgttgttccagttgttccagcgtttgtgcaaca
gttaatcaaataaacagagaaactcatcagggtcctaaaaacaagacccatgtccattac

 3.09 Term + 115296 115322   27  2  0   90   49    85 0.498   1.90
acaagccaccactgtttcttgactcattctattccctacacagggaataccctcaccctc
ctgtttctgacctcctttctgttctgcaaggccctgatcaaatgctcccttcctctgtaa
accttcctcattcctcacttctctcactctaataacctttgcccatccttctattactag
CTTTGTACCGTCAATCGAGGAAAATGA
cgaggcaagtctcaatcattttaggaggtttacttgccaaagttaaggatgtgcctggga
gataggtctatgcctttatctgaagatgattttgagggctccagatttaaaggggaaagg
gtggggatattgagaagtacacaattttcatctaagtgaatctgtgttttgtacataaga

 4.01 Init + 124467 124578  112  2  1   44  111    65 0.112   4.82
ccactcacctgaataaacagtacaaggtgctggaaattgtggaaacatgattattaacaa
agtagaatccttcaatccttaaactgactactgtattactttcctagggctaccttaaca
aagtatcatgtactctgtggcttaaaataacaggttgtccttcaataggtgaatggataa
ATGACTTCAGTGGATGAGTGGATAAATAAACTGTGGTGCACCCAGACAATAGAATATTAC
TCAGAACCAAAAACAAATGAGCTCTTAAGCCATGAAAAGACATGCAGGAAAC
gtaagtgcatattactaagtgaaagaagccagtctgaaaaggctgcatactgtaggattc
caactatgtgacattctgaaataggcaacactatggagacagtaaaaagatgagtggttt
ctaggcactagggcaagaagagagggatgaataggcagagcacaggggatttttagggca

 4.02 Term + 136605 136789  185  1  2   98   45    94 0.662   2.82
accacattctacctattatcacatccttaacaggtcttaacttccctacagattatgaac
tcctttcaggggttgaatttatcttggtttctgccctcactggcttgaatggagtaaatg
ttcaataaatatctgttgaatggatgtgctaattccagccacctgtgtgtccatttccag
GTTATAGCAGCAAGCATTACCTACCAGCATCCCACAACCGCAAGTTCAGACTCCACCTTG
GTATCTGGCAGATGGTTCTGAACAATGGTTTGCCACCTCCTCCTCAGAACCTAGGCCCCC
ATGCCTCCTCCTCGGAACCTAGGCCTTCATGCAGCCCCCTTGCTGCCCAGAGCTCACCAC
TCTGA
tgacagttctgaattgaactgtccttgcctccaagtctaggttccacgtggatcagtcag
ggagaggaatgtataccagattagcaacccataagtcagtgccagtgctgtcactttgta
attcagaaatatgaactttttttttaagtcaagtcagtgatcttcaccactgaagcagtt

 5.01 Init + 142078 142269  192  0  0   74  100   131 0.913  11.91
tgtttccaacctacatgaggtttttaactttttaagttggatcccaaattaagacccagg
ttcagacaatgccattagcagaaccaataatgatgggaatcaaataaaagtaattgacta
agaagtcatccttttttgaggctgtgagccccaggcattcttctttggggtgtggccttc
ATGGGGAGTGTATTGCTGCAGAAAGCTGGGGACAGAATAGTGTTCTGGATTGAGTATCTC
AGTTACCAGCCTGAAATCTCCATCGACCAACACTGCCTTCTCTCAAATGACTTCTTATAT
GAAAGTGGACAGACAGTGGAATGCAGAAATTTTAGAGCTGATCTTGGGGACCGGTCAACT
GTCTACTGGCCA
gtaagttactatgaattcaaaaatggtgaacttcaatagcattcattctgtcagatagtg
agtttatttgatctgttggaattttaggtgcagagttctttttcaaaatataggaatgtg
cagaaacaattaaggaaaacagacttggaaactttgatctgaatggagtcctctttaagt

 5.02 Intr + 150317 150450  134  1  2    9   84   256 0.518  15.82
ctagctgactaggtcgctaaacttaaggaactgaaccatccttttagacgtatgtggttc
attaagcagtgaagttcagaaaagggctcagggctgttcctgccaagaggttggtgaaga
cacgtggcaagtggcacgctcaagaggttgtctttgtaatgttgcagaatcgcctaccag
AGGAATGACGATGATGAAGAGGAGGCAGCCCGGGAACGGCGCCGCCGAGCCCGACAGGAA
CGGCTGCGGCAGAAGCAGGAGGAAGAATCCTTGGGACAGGTGACCGACCAGGTGGAGGTG
AATGCCCAGAACAG
gtactgtcctctttgggacggggagtttctaacttgcgtcttagcctgtccgttgaatgg
aatttgttgagcagagcattcctttctcagcccaactcaaccctttttcaatctaactgg
tttaattattttgcagtcattttaggcaactaatctgattagacaggcaatctgatttag

 5.03 Intr + 153982 154092  111  1  0    5  116   103 0.852   3.38
acacttagatgtctcttccattggggtcactggcgtgagtgtggaatctcaacactgtaa
tgtacattttcttcctctcaaagtaccttgggagcctccaatccagatcaggaattctag
atgacttgatgacatgggagaatactacatgacatggaaggaattcacttattatttcag
TTTGATCCTTAAGTTTGAATTCCCCAAGAAGCAAGTCCAGAAACAACGATTTGACTGCAA
GTCGTTTATTTGTAAGGTGATGCTAGGAAACACTGGTGGAGGTGTGGGAAG
gtaagacagaaaagggaaggccaccaaataaacgttgcatgaccaagcacatcaccactg
tgggtatctggagcttcactccactgggaaactctgagatccagtgtggaatacacacct
cggagttatcccactcaaaaagtgaggggtgctgaggtatctaaacactcaggctatcaa

 5.04 Intr + 154538 155627 1090  2  1   67   92  1479 0.811 135.31
cttgcaaatgctgtcagctgaaagccaggcaggcgtgtactaaaatggtaacgtactggg
gatatgggcaagcttggcactactggcatctgctgtagtcctgggtagcacaggctgtat
gaatgctgctgactgatgaatgagcaagctgtctttggtgttgttctttctgttgtacag
TGTGCCTGACGAGGAGGCCAAGACAACCACCACAAACACTCAAGTGGAAGGGGATGATGA
GGCCGCATTCCTGGAGCGCCTGGCTCGGCGTGAGGAAAGACGCCAAAAACGCCTTCAGGA
GGCTCTGGAGCGGCAGAAGGAGTTCGACCCAACAATAACAGATGCAAGTCTGTCGCTCCC
AAGCAGAAGAATGCAAAATGACACAGCAGAAAATGAAACTACCGAGAAGGAAGAAAAAAG
TGAAAGTCGCCAAGAAAGATACGAGATAGAGGAAACAGAAACAGTCACCAAGTCCTACCA
GAAGAATGATTGGAGGGATGCTGAAGAAAACAAGAAAGAAGACAAGGAAAAGGAGGAGGA
GGAAGAGGAGAAGCCAAAGCGAGGGAGCATTGGAGAAAATCAGGTAGAGGTGATGGTGGA
AGAGAAAACAACTGAAAGCCAGGAGGAAACAGTGGTAATGTCATTAAAAAATGGGCAGAT
CAGTTCAGAAGAGCCTAAACAAGAGGAGGAGAGGGAACAAGGTTCAGATGAGATTTCCCA
TCATGAAAAGATGGAAGAGGAAGACAAGGAAAGAGCTGAGGCAGAGAGGGCAAGGTTGGA
AGCAGAAGAAAGAGAAAGAATTAAAGCCGAGCAAGACAAAAAGATAGCAGATGAACGAGC
AAGAATTGAAGCAGAAGAAAAAGCAGCTGCCCAAGAAAGAGAAAGGAGAGAGGCAGAAGA
GAGGGAAAGGATGAGGGAGGAAGAGAAAAGGGCAGCAGAGGAGAGGCAGAGGATAAAGGA
GGAAGAGAAAAGGGCAGCAGAGGAGAGGCAGAGGATAAAGGAGGAAGAGAAAAGGGCAGC
AGAGGAGAGGCAGAGGATAAAAGAGGAAGAGAAAAGGGCAGCAGAGGAGAGGCAAAGGGC
CAGGGCAGAGGAGGAAGAGAAGGCTAAGGTAGAAGAGCAGAAACGTAACAAGCAGCTAGA
AGAGAAAAAACGTGCCATGCAAGAGACAAAGATAAAAGGGGAAAAGGTAGAACAGAAAAT
AGAAGGGAAATGGGTAAATGAAAAGAAAGCACAAGAAGATAAACTTCAGACAGCTGTCCT
AAAGAAACAG
gtacagtaaacattttgcaccaaatgtgtgatgcctgtgacttgtgagaaatgtaatgca
catctgatttgggactgaggccacatgcatatagctcacatgcttgatcatttggcaagc
tgttcattttttcaggccatagcgatacacaagcatgcagcaattgattgatggctgaat

 5.05 Intr + 162642 162787  146  2  2   48  110   179 0.294  14.26
gctaaaggaccatagctcattctctaagaatttcacctgattccaactctaccacatctg
agtggtttctttctgagttttctgccttcctaacaattttgggtcttacttgatgatacc
aaccaaaacctaataagatttttcttgttctgtttcttcctgatatgtactgttggttag
ATCAAAGATGAAAAGATTAAAAAGGACAAAGAACCCAAAGAAGAAGTTAAGAGCTTCATG
GATCGAAAGAAGGGATTTACAGAAGTTAAGTCGCAGAATGGAGAATTCATGACCCACAAA
CTTAAACATACTGAGAATACTTTCAG
gtaagaagtagcaactagttaatagaaactgtgttcacatgcaaagaaaaaaaaaaaaaa
gtcagtcttcccatcctgtgcttccagacagaaacgtgctaagcaggcagcatgcttttg
ttgtgaggtcattagccattgtcttagagatactcagtcagcaggtccagttcttatatc

 5.06 Intr + 169058 169319  262  2  1   66   94   419 0.101  36.87
agcagaggctcctggactctgtgattccgggcagaccccttccccagcctaccccctggg
ctaatgagaggcagtgggtatttagtcggggatgcagaagccgcagaccgacctcccctt
cctccagggagactacaggcaaaagcatgtaaacccctttccattgccccccaaccacag
CCGCCCTGGAGGGAGGGCCAGCGTGGACACCAAGGAGGCTGAGGGCGCCCCCCAGGTGGA
AGCCGGCAAAAGGCTGGAGGAGCTTCGTCGTCGTCGCGGGGAGACCGAGAGCGAAGAGTT
CGAGAAGCTCAAACAGAAGCAGCAGGAGGCGGCTTTGGAGCTGGAGGAACTCAAGAAAAA
GAGGGAGGAGAGAAGGAAGGTCCTGGAGGAGGAAGAGCAGAGGAGGAAGCAGGAGGAAGC
CGATCGAAAACTCAGAGAGGAG
gtaaggcgggcgctagcccactgagaacgttgcccgggaaaattccctagtgccgtgcgg
ctgttcttttgagcatgggctctcaaaaatatttttttaagaataataaacttaccatgt
gctaggtactgttttataacttgtagatgtattaatttgtccactgcttctaagaactcg

 5.07 Intr + 171923 172063  141  1  0  116   63   220 0.978  21.93
aaatgcaggcagctcgactccagctctcaggctaaacctctggtgaccacctagaagggg
agtgtccagcctgcggcctgagtctgctgcctctccaactgtgctctctctcctacagca
ctcttccctttggctgtgaagctggtactgatgcctcgttatttgttctttctctcttag
GAAGAGAAGAGGAGGCTAAAGGAAGAGATTGAAAGGCGAAGAGCAGAAGCTGCTGAGAAA
CGCCAGAAGATGCCAGAAGATGGCTTGTCAGATGACAAGAAACCATTCAAGTGTTTCACT
CCTAAAGGTTCATCTCTCAAG
gtatttttttccccagaaaacttctattagaatatgatagagactggattttagcccctt
gtttagttattgattatacagggcctttgttcatttatctttttgctatccttccaagtt
aatctgttcaggctgctataacaaaatactttagactggggccaggcacggtggctcatg

 5.08 Intr + 179615 179658   44  1  2   90   94    38 0.968   0.72
cactatcaaataccttatatgtagttttgctttctagcagagctacgcacagtaactcaa
atacccttatatgctcttcggtgtgtttaacaggttcagggatgatattggcctgggctg
agaaacactgtttataagcttgaaatattaattgggtttattttcttttgtaattcctag
ATAGAAGAGCGAGCAGAATTTTTGAATAAGTCTGTGCAGAAAAG
gtaaatatgcttgatggttcaattgagctaatcagctagcatatgtatgagaagattctc
tctcatatttttatatgtatgtgtttacttttttagcagtggtgtcaaatcgacccatca
agcagcaatagtctccaagattgacagcagactggagcagtataccagtgcaattgaggt

 5.09 Intr + 179755 179836   82  1  1   76   78    91 0.912   5.62
tgaaatattaattgggtttattttcttttgtaattcctagatagaagagcgagcagaatt
tttgaataagtctgtgcagaaaaggtaaatatgcttgatggttcaattgagctaatcagc
tagcatatgtatgagaagattctctctcatatttttatatgtatgtgtttacttttttag
CAGTGGTGTCAAATCGACCCATCAAGCAGCAATAGTCTCCAAGATTGACAGCAGACTGGA
GCAGTATACCAGTGCAATTGAG
gtgagaattgtcctcagcgttatggtcctgctgaacagaaatagattctgactacataga
agagcataaaaacacttaggacaataatcaagtccaatagccccaggagtgttagaattt
tttttttttttttttttgagacggagtctcactctgttgcccaggctggagtgcaatggc

 5.10 Intr + 181519 181656  138  0  0   24  105   156 0.998  10.64
ttttgagggacatatgtcatcagcatacagttttacaacagaaattatcactctcatttt
tggtggaggtgtttacacaatgaatttttaagatgataatgttgaggaagacaaactcac
tataattttatgagaacaaacttcccagcaccaatcctaaaaataactcacaaatttcag
GGAACAAAAAGCGCAAAACCTACAAAGCCGGCAGCCTCGGATCTTCCTGTTCCTGCTGAA
GGTGTACGCAACATCAAGAGTATGTGGGAGAAAGGGAATGTGTTTTCATCCCCCACTGCA
GCAGGCACACCAAATAAG
gtgagcatctgatttttgtctcttaagtgtagaggggcatatttttttgcatgtcgattt
tgatttaggaatcacactagtaaataataaaagcagtgaagaaggtgcaatttgtacttt
gttttgcaatgaccacaaaagcaagctcagagagaatgtgtttgtgaggttgcatgaggt

 5.11 Intr + 182078 182173   96  1  0   82   84    63 0.901   4.59
ttggagtggggtgagttaccagggaaagaaaaccagataacatattctgtaaatatcaag
tgttaaggtttatggttatgtgaaatcatacttaatgatattttgaatttgctttgaaaa
ttccttcccaggtaaagtttacttcattctttaatattttggatgattgcccctttgtag
GAAACTGCTGGCTTGAAGGTAGGGGTTTCTAGCCGCATCAATGAATGGCTAACTAAAACC
CCAGATGGAAACAAGTCACCTGCTCCCAAACCTTCT
gtaagtacctttaggtttttctgagtttctttgatctcccagcttctaccagcagaagaa
aacaagcagttggtctgtttacctaggaatggcagtgcccctgttctttgctttccctga
tgaatagcaaacaggaaagtgttcagatttacaacagttctaagaagctgcatctcagtt

 5.12 Intr + 186851 186931   81  1  0   92   84    34 0.277   2.32
aaaaaataaaaaaatcaaacaacagctgatggtcctttcaattccatttcagatcactgg
ggtaaagtgtattaaacaacaaactgattcaaataaacaatagatgtggccatttattta
gagctggctagaaaatataaatggccacctatcgatgtttttctgcttcctttttatcag
GACTTGAGACCAGGAGACGTATCCAGCAAGCGGAACCTCTGGGAAAAGCAATCTGTGGAT
AAGGTCACTTCCCCCACTAAG
gtaatctattgggaagactagtatttcagaggtttgttttcctgatgtatggtgtagtat
aatgtcctggagtcagatgagaaatatcactgacctacagatctttgcctgcacacccat
cagtgtctaaaagaccagtacataacacagtgaaatgaaaagcgcattgcaagtttgtca

 5.13 Term + 187488 187595  108  2  0   37   38    86 0.036  -3.97
aaaactgctttctggaaccattttagattacattgccactgccagcagcctaagactcag
ggttgctatggcaaaaaaaaaaaaaaaaatattcaaaagtaaggcaaccatttaccaccc
tgtgaaaatgaatgattaagaatgattgggttcctcttacttttagtcttctggtcaaag
GATATGGTCATTCTTCAGAAAGGAGGCTCTGAAGAACATCTAAATGATGCTTACACTGCA
AATGGGACCCTTTGTGGTACAATGAGCTCATTCAACTCCCAACTGTAG
cctttccccatttcaagtaatagacctcgtgttctccttcaataaaaagaaaattaaaaa
gggagaaactggagaccaacaataagcaaggttagaacaggctgcttatgggttgattta
aacagaagcacttcgtaagcaaactcaggactaaagagcacatcaacggcaactagagaa

 6.02 PlyA - 187901 187896    6                               1.05
 6.01 Term - 188662 188392  271  0  1   79   38   209 0.576   8.97

Predicted peptide sequence(s):


>CALD1_1|GENSCAN_predicted_peptide_1|143_aa
MASVSCSPVCTQKKEIKGEEELKWTGPGNTEEIFQLIEQQKEADTCAELSHTSGKGWICD
HQSKNSDNIGIDQYSLDTAQGSRNNQEREDITQGSLNTRKEEIIRDTRHAQEITHQKTQD
LKSSETACTLPKPACSMPFFGYP

>CALD1_1|GENSCAN_predicted_peptide_2|113_aa
MTKEQHQQNRNTSVVVMGSCARGETLIKEEEEEEEEGEGEEGEEGGGGKKSLFFLLLGLT
TVLTSSSQAPCSQLLLPCVKSETLAEERGEEISLGFWIWFSVANLDFPVTEQD

>CALD1_1|GENSCAN_predicted_peptide_3|400_aa
MPYKQQSVLVDNDDSGSGSGDDYDDEGKRNNCHYLFTNFGLFIIYTRSFVMSGSYTQLKL
QKCMVSELQQSISSMEAEPLYITLCCVLKQRTHSVNKQVGSCIHQIHPAWGFAGVEGTSG
YGQQEARDKGPEAEMRVKLLQDSGVWLGSVQEQTNAQCKDLGSERCFGAQQTYGLMSTFT
CPVVNADLSGDQAQYEYSHLRGTKVQTSSGLPEPEITPWMILSVAENLEGKRGRRCDSKQ
KGNCFKVEAVLKQLLQTLKSGTDLVVRSPTSMNPRHQVSEDSWKHLPSPALLSAHDSLVI
SMRLPALPVFHWPLCSSSSQRVSEPGPRLTSLFTLPMSVPYQAGKQKPEGQLNLPQSRQQ
SVAKPCLCTLMQRAVFTLVFMRFEKLTGSWEKLCTVNRGK

>CALD1_1|GENSCAN_predicted_peptide_4|98_aa
MTSVDEWINKLWCTQTIEYYSEPKTNELLSHEKTCRKRYSSKHYLPASHNRKFRLHLGIW
QMVLNNGLPPPPQNLGPHASSSEPRPSCSPLAAQSSPL

>CALD1_1|GENSCAN_predicted_peptide_5|874_aa
MGSVLLQKAGDRIVFWIEYLSYQPEISIDQHCLLSNDFLYESGQTVECRNFRADLGDRST
VYWPRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNAQNSLILKFEFPKKQ
VQKQRFDCKSFICKVMLGNTGGGVGSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERR
QKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETET
VTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQVEVMVEEKTTESQEETVVMS
LKNGQISSEEPKQEEEREQGSDEISHHEKMEEEDKERAEAERARLEAEERERIKAEQDKK
IADERARIEAEEKAAAQERERREAEERERMREEEKRAAEERQRIKEEEKRAAEERQRIKE
EEKRAAEERQRIKEEEKRAAEERQRARAEEEEKAKVEEQKRNKQLEEKKRAMQETKIKGE
KVEQKIEGKWVNEKKAQEDKLQTAVLKKQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKS
QNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEK
LKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRA
EAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVS
KIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNK
ETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKD
MVILQKGGSEEHLNDAYTANGTLCGTMSSFNSQL

>CALD1_1|GENSCAN_predicted_peptide_6|90_aa
XALARRNVIQRDSVILVMMVYGQLTSAFQTGTYINTGTAILRSQIPLRGLRGEPSAVNVP
PTVVCGECLPGNHSMGLGYLHCMADKPAMR