GENSCAN 1.0	Date run: 16-Jan-104	Time: 22:05:24

Sequence AZGP1_1 : 11414 bp : 48.47% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1276   76  0  1   72  101   160 0.936  14.95
tgtagattcattcttcataacctctgcccagcctagcttgtgtatcatttttttttctct
attaggggaggagcccgtcctggcactcccattggcctgtagattcacctcccctgggca
gggccccaggacccaggataatatctgtgcctcctgcccagaaccctccaagcagacaca
ATGGTAAGAATGGTGCCTGTCCTGCTGTCTCTGCTGCTGCTTCTGGGTCCTGCTGTCCCC
CAGGAGAACCAAGATG
gtgagtggggaaagcaagggatgggtgctggagaggactggaaggaggtgaggaacagga
catgtggctgggagacaggctggatgcagctgggataccctggcatacggcaggaatggg
tgcccaaggctgtcaactccctcagctcacacacttccaggagcattcagggagcctctg

 1.02 Intr +   5216   5476  261  0  0  126   73   246 0.991  24.36
catctcaggcatgaaagtagagcatattcacttgagtgagcctccagtggtgtgaagttg
atggcaggagaaagagctggggaagaaaaggccagtggcaggtctcccctcctagcccta
tgcagccccacagtgggacccttgcatggacctcaaccatcagaatcttttcttttgcag
GTCGTTACTCTCTGACCTATATCTACACTGGGCTGTCCAAGCATGTTGAAGACGTCCCCG
CGTTTCAGGCCCTTGGCTCACTCAATGACCTCCAGTTCTTTAGATACAACAGTAAAGACA
GGAAGTCTCAGCCCATGGGACTCTGGAGACAGGTGGAAGGAATGGAGGATTGGAAGCAGG
ACAGCCAACTTCAGAAGGCCAGGGAGGACATCTTTATGGAGACCCTGAAAGACATCGTGG
AGTATTACAACGACAGTAACG
gtcagtgaataacagaccacaggggtggaaggtctaacccaagaggcagcccccccagtg
tgagtggcaagggatcagcaggatggaaatagtcccaatcccaggggaagaacaggagac
acagcagaaacacagacatgtccacatcccacccaccccacagcacaggtgctccccgct

 1.03 Intr +   8788   9063  276  2  0  -11   73   272 0.154  13.29
ccctctctgtctgttgtatatattggagtaataacctatttgtcttgataaagggattgc
atgcttgaattgcaaaaacctttatttcttttgggttgcccaatgtgcaagactaagagt
tattttgataaatttctcaccaggctgactgtctctctgtggggtcgggggagttttcag
GGTCTCACGTATTGCAGGGAAGGTTTGGTTGTGAGATCGAGAATAACAGAAGCAGCGGAG
CATTCTGGAAATATTACTATGATGGAAAGGACTACATTGAATTCAACAAAGAAATCCCAG
CCTGGGTCCCCTTCGACCCAGCAGCCCAGATAACCAAGCAGAAGTGGGAGGCAGAACCAG
TCTACGTGCAGCGGGCCAAGGCTTACCTGGAGGAGGAGTGCCCTGCGACTCTGCGGAAAT
ACCTGAAATACAGCAAAAATATCCTGGACCGGCAAG
gtactcactgcttcctgctccccagtactgagcccagaataaaagacgatctcaggctag
gagctcaggcaacatcttagtccggtctcatctgttcctggatgtccctcagacccccag
ctttcatcttttaggatttattccttccctgggataatataatttgtggtccaaaaagaa

 1.04 Term +   9932  10215  284  0  2   99   49   298 0.995  22.59
ggcaagagggaaagcgtcagccttccctgatattctggaaagtctcccggggctgggggt
gggcaggtacagagcttcgagctctgctgatcgctgacatccaggggtgggggtaggaag
agacctgggccgggagaagtccacctcaagcctgcagtgtcacactctatccctccacag
ATCCTCCCTCTGTGGTGGTCACCAGCCACCAGGCCCCAGGAGAAAAGAAGAAACTGAAGT
GCCTGGCCTACGACTTCTACCCAGGGAAAATTGATGTGCACTGGACTCGGGCCGGCGAGG
TGCAGGAGCCTGAGTTACGGGGAGATGTTCTTCACAATGGAAATGGCACTTACCAGTCCT
GGGTGGTGGTGGCAGTGCCCCCGCAGGACACAGCCCCCTACTCCTGCCACGTGCAGCACA
GCAGCCTGGCCCAGCCCCTCGTGGTGCCCTGGGAGGCCAGCTAG
gaagcaagggttggaggcaatgtgggatctcagacccagtagctgcccttcctgcctgat
gtgggagctgaaccacagaaatcacagtcaatggatccacaaggcctgaggagcagtgtg
gggggacagacaggaggtggatttggagaccgaagactgggatgcctgtcttgagtagac

Predicted peptide sequence(s):


>AZGP1_1|GENSCAN_predicted_peptide_1|298_aa
MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFR
YNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGR
FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKA
YLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWT
RAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS