GENSCAN 1.0	Date run: 16-Jan-104	Time: 21:17:27

Sequence ADCY1_1 : 151101 bp : 47.72% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1223   1861  639  1  0   91  127   982 0.999  95.74
aggggacgcgctccgggcgcgcgcgcggggcagccggcgccccaactccgcccgccccgc
gccccgcgccccggcgcctcgccgcccgccgcccgcccgccccggcgccgccgcccgcgc
cccggcgccccgggccggcgaggggcgcgcccgcggccgcggccgctgcatggcgctgag
ATGGCGGGGGCGCCGCGCGGCGGAGGCGGCGGCGGAGGCGGCGCGGGCGAGCCCGGGGGC
GCCGAGCGGGCGGCCGGGACAAGCCGCCGGCGCGGGCTCCGGGCGTGCGACGAGGAGTTC
GCTTGCCCAGAGCTGGAGGCGCTGTTCCGCGGCTACACGCTGCGGCTGGAGCAGGCGGCC
ACGCTGAAGGCGCTGGCCGTTCTCAGCCTGCTGGCGGGCGCGCTGGCGCTGGCCGAGCTG
CTGGGCGCGCCGGGGCCCGCGCCCGGCCTGGCCAAGGGCTCACACCCGGTGCACTGCGTC
CTCTTCCTGGCGCTGCTCGTGGTAACCAACGTCCGGTCCCTGCAGGTGCCCCAGCTGCAG
CAGGTCGGCCAGCTGGCGCTGCTCTTCAGCCTCACCTTCGCGCTGCTCTGCTGTCCTTTC
GCGCTGGGCGGCCCCGCCCGGGGTTCCGCCGGGGCCGCTGGGGGGCCAGCGACCGCCGAA
CAAGGGGTTTGGCAGCTCCTTTTGGTCACCTTCGTGTCCTATGCCTTGCTGCCCGTGCGC
AGCCTGCTGGCCATAGGCTTTGGGCTCGTGGTGGCTGCGTCGCACTTGCTGGTCACAGCC
ACCTTGGTCCCCGCCAAGCGCCCACGTCTCTGGAGGACG
gtaagtgcagccgcgcacccctcatctggtctcggacacacttgctgggacgatgctggg
aatgcccggagtcgggcgcgctttttcctatgcggcgggtggggacactgaggctccgag
tgggggtgtgttcaaggtcactcctacgagttggggacgcagtcggggctggcaccctcc

 1.02 Intr +  19435  19584  150  0  0  118   82   277 0.853  30.46
ggacagggtgaggacgagctcctgcccggctgactccctgtgtccctggccctgcgctgt
gggtttggcccgggcggcgtggcttttggagagctcttgctatgctctccgggcggccta
ggccctctttgtgtgtgtgggatgtcaggctccacatgttgcctccttctctccctgcag
CTCGGTGCCAATGCCTTGCTCTTCGTCGGTGTGAACATGTATGGGGTCTTTGTGCGGATT
CTGACTGAGCGTTCACAGAGGAAGGCGTTCCTGCAGGCCCGGAGCTGCATTGAGGACCGA
CTGAGGCTGGAGGATGAGAACGAGAAGCAG
gtcagtggcttgggccagtcagcctagaggggttggctgtggggctggggaggtggaaga
agctggcttcctgagcctcagtttaccccgtggtgacatgggccacaattcccattggta
catgttggtatttgaggctgtggaggagatgccctgaggttttatagttagcaaatggac

 1.03 Intr +  22161  22318  158  2  2   72   62    58 0.454   0.41
gcccctagggtggggcccaggggggttggggttctgatgagctgctctgcagtccctgtc
tttctcccgttctccctctccttctgcctattggtttccaactttctccctccctgcctc
cctctctctctgtgaggacttgtcacctcctgtttcccctgcccctttccgtttactaag
GCTGACGGCGACTCCTTCATGCTTGTTCACCTTCTGTATTTCTTTGTGATTAGTACGCTT
CAACCCTCCGTCCCGTTACATTCTGACTTTCCTGGCAGTCGGGTGAACTTCTCACTGTAT
AACAGAGACACTGATGCCTCATCCCCACGTTTCCCCAG
gtctgttcctccagctttgcttttccttgtgtaaaattcaatctcttatattttcaaatg
gaaggatcattttctttcatgatttcctctgttgcttcatagctgagctgatgttttgac
acatgagcgctgattgaggacgtgccttccctgactttaccaagtatatcctcagacctc

 1.04 Intr +  24709  24733   25  1  1  121   74    23 0.189   2.23
tctggaaagttctctgctgtacttaggaaaggtttacctgaattgtcagtgtgcctgagg
ctgattcctttggggggatttgaatgagctaaaatgacccctcctctcaacacagcaaaa
caaagaaacagaacaaagggtcaccctgggcccctgcccttcatctgtccttgcctgcag
GGTCTGGGCAGAGAAGAAGGTCAAG
gtactaagatgttctttctgagttgtcagatctctttaaaattaatttcagccctctata
tcatggttaggaatgtaaggactttattctgcttaataaatctgagaactggggctctga
aaatttaaataacccaggaaagataacggagcgaataatagagtcaccagtggcagagcc

 1.05 Intr +  26187  26276   90  2  0   59   68    56 0.187   0.89
cttgttcccctgtggctggcacagcccactgggttcttcagtctccttagctctccagga
gcactacattgggcccctcagtcaccgccttctgcttggttttcgtggcttgtgcgtcac
agtttgctctgtatcagctccgggaatcccagagtctcctccctgtcattctgtggccag
TGCTGCAATATTGCTGAGGAAGATGCCGGAGCTGGTTGTCGCCTTGGTCTGTGGGAGGCT
CTGCGGCATGTCCTCGGGGGCTGTGAGGAG
gtttgtgggtacccagttgtttgccatatctgttttttttttttgaggcagagtctcatt
ctgtcaccccagcttgagtacagtggcgctatctcaactcactgcaacctccgcctcccg
ggttcaagcagttctcctacctcagcctcccgagtagctggaattacgggcatgtgccac

 1.06 Intr +  37055  37173  119  1  2  110   75   187 0.430  18.86
gaggctgtgccagccctggctagtgctcctggagggagttgcttgttcagtggcagtcca
gccctggacgtgggcctacccaggctcaggggcccggcgcccttactggggagggtgagg
tgaggaggagtggagggagggggccctgctgtctaacccgggcccttctcttctgtccag
GAGCGGCTCCTCATGAGCCTCCTGCCCCGGAACGTTGCCATGGAGATGAAGGAGGACTTC
CTGAAGCCCCCTGAGAGGATTTTCCACAAGATTTACATCCAGAGGCACGACAATGTGAG
gtagggctggtgctgacccggcacagcggggagcctgggaagctgaggtgtggagataat
ggtgaaggtggggaggtgatgacagaagtggggaagggatggatggaggtggggaaagaa
tgggggtgtggaggtaatggtgaaggtggggaagtgatgatggaagtgagaaggtgatag

 1.07 Intr +  49310  49421  112  2  1   77  127   206 0.999  23.78
agcctcagtcttctcacctgtatgatgggaaccaggaagccttcatttctggtctgcatt
gaggaataaatggggtgattgattctacagtgatttggagatgtaaacatctgtacatct
ctagggattatttcctgagtgactgggagaagggcagcctggcacccctttctcttgcag
CATCCTGTTTGCTGACATCGTGGGTTTCACGGGCTTGGCATCCCAGTGCACAGCCCAGGA
GCTGGTGAAACTCCTCAATGAGCTCTTCGGCAAGTTCGATGAATTAGCCACG
gtaagtgcagcgtttttctttgttcgaattaaattagaattgcttctggagtgacgataa
gccaggtggattccctgtatttggaccatgaactagactgattgctaagcatttcttcca
gcaaggttataaatcacctgttgtttttagcctcactgttcattgattcctttccttgaa

 1.08 Term +  49892  50047  156  1  0   97   53    33 0.505  -1.37
acgggtctgtcctgtgcaccatcctgctgccattgtgtcccactgtagacagagctggtg
ttgcaatccctcgttctgggctctactggagcaggcctgattctgggtctgccaccctcc
tgggattgaaacttgtcagctgggggcccagttgctgacgtctcctgatgcctggtgcag
GCAGTGGCCACCCTTGCCCTCAGCAGACTGCGTGCTGGGGTTTTGAAAGACCTTCCTTGG
ACCAGTCACATCTGGCAGCCAAGTTCTGCTGAATGTCGGGCCAAGGCCATACCAACAGCG
TTGGCTTGTAACGTGCATGTTAGGAAGCAAAGATGA
gcaagctagccaaacctccttgtacagaggtttgccctcctgggacttagtcacattggc
cacaaggctcctgaggggctgccactgtccccctttctcccccacagaatgtgctgtgtt
tagagataggacatgtcgggctgggatctgagctgcagaagccaacagacgttgcaggcc

 2.05 PlyA -  51229  51224    6                               1.05
 2.04 Term -  51604  51314  291  1  0  115   45   121 0.705   5.84
 2.03 Intr -  53285  52969  317  0  2   82  -27   146 0.342  -1.72
 2.02 Intr -  54591  54489  103  0  1   79   90    89 0.891   7.95
 2.01 Init -  63845  63786   60  2  0   89   87    14 0.092   2.65
 2.00 Prom -  66075  66036   40                              -5.56

 3.01 Init +  75249  75257    9  2  0   82   64     0 0.270  -2.51
attccagagggctgtccgtgatggtctgcatggcggttaagggaggtgccgtgggaataa
agggagttggggaagatgccccatggagatggcattccagccggaccttgaatgatcatc
ctgtagggttggctcagtgaagcagacaggagggatggacccccgaaggggaaagaggcc
ATGAGCGAG
gtatggggaaagggagaaggagatcaatgtgagcctggtcccagccctcaagactgtgct
gaccacgcaagggtgtggcctgggcgggaaggtggtggcccaggtgcagcatgtcttgcc
agcgctctgtggccaccagtgtctagaggtggtggagccagcagtggcgctcacagcctc

 3.02 Intr +  75480  75607  128  2  2   51  113   149 0.739  13.18
agccctcaagactgtgctgaccacgcaagggtgtggcctgggcgggaaggtggtggccca
ggtgcagcatgtcttgccagcgctctgtggccaccagtgtctagaggtggtggagccagc
agtggcgctcacagcctctgtagcgctgtctcttaccatgtgccttgcccttccctgaag
GAGAACCACTGTCGCCGCATCAAGATTCTCGGGGACTGCTACTACTGCGTGTCGGGCCTC
ACCCAGCCCAAGACTGACCATGCCCACTGCTGTGTGGAGATGGGACTCGACATGATTGAT
ACCATCAC
gtaagtaccccgtggggctgagaggagtggcctggggcatctacacattgaaatcctaga
agctgagccaccttctgccccatgtgggctcccctctcagggtctcgctttgtcctgatg
ggtctgtctgaggctgcagagaatgatgccagcattaggaggatgctgggttcaggaaag

 3.03 Intr +  84537  84695  159  0  0   93  110   242 0.996  26.00
aggtgggcaggaaggctccatgtccactgactatgccaggagacctccacgctcaggcca
catgcagcaaggacaagacccagtttccctggtgctcacagcctagcagtgcagaccaag
gtggccccctgggaggatacaaggtgggcgccagccccacgctctgtgtctgtgttgcag
ATCTGTGGCTGAAGCCACCGAGGTGGATCTGAACATGCGTGTGGGTCTGCACACGGGCAG
GGTCCTCTGTGGTGTCCTGGGCTTGCGCAAGTGGCAGTACGACGTGTGGTCCAATGATGT
GACCTTGGCCAATGTCATGGAAGCCGCTGGCCTGCCAGG
gtaagtcggggatggggtggggaggggagggaggtgggtgatggctgtgcacccctgggc
taaatccttgcttcaggttctgggctgtgctcttgagggcacttgtgtgagtgctcctgg
aggacctgcctgtcccagccgcacctgccaaccagactccctgtggtgggcgtcccaccc

 3.04 Intr +  85456  85629  174  1  0   66   49   170 0.754   9.95
atctcccttttgtatgatctcgcagtggctatcatggcaggcagcttctccagaacactg
gctgcccctcagcaggcaacttttgcagaacactggctgcccctcagtgtgcccggggct
cagcataaagcaggggcttcagtgagagctggtgttttcctctccccgttggctcccaag
GCCGGGCCATGCAGCCGCTGTCTTCATTGCTGATGGAATGGATGAAGCATCAGCTGAACA
CAGGAATGCACAGACACTTGCCTTTCTGGAGACTGTGGTGACTGGAAGTTTCCAGACAGC
CTCGGTGACCGTTGTAGTTCAGGGCCAGGCTGATGGGGGTGACAGTGTCCCCAG
gtgcttccagggcccctccgggggggcaggaagcagcaagggttgaggcttgccgtgagc
gccctgcctgccccaggccaatgggagctgctgatggggacacccagggagcatcccagc
agggactgggcccggggatccaagcactctgagttgatgacaggaatcggcccctgtaga

 3.05 Intr +  86851  86992  142  1  1  118  102    73 0.997  12.06
atctgcctgggccctccctcctggcatggacggacttgcatgggagcatgaatactcccc
gtggagcctgccctggtgtggggaagcctctgtctgtgccccttcccctctggtaaggcc
ctgcagactctgacagcagtggttccccactcatctggcctctgcctcctccttttgtag
GAAGGTTCATATCACAAAGACGACCCTAGCGTGCTTGAATGGGGACTACGAGGTAGAACC
GGGTTACGGACATGAGAGGAACAGTTTCTTGAAAACTCATAACATCGAAACCTTTTTTAT
TGTGCCATCCCATCGCCGAAAG
gtaggcaccagagcccccctcatttggttgatccttagcttcttggcctgtgcagagctt
tacagatgtgactcctcctgcttcctctccaagcactgcttctctgggctgtgaacttgc
taagatggggagagttgtccccactgacaccgtcctgagccttgtctcttactggtgtgg

 3.06 Intr +  88868  89023  156  1  0   72   97   266 0.997  26.11
tggttttgtttgctgctctattctgggcacgttccccaatgcctggcttgaagtaggcgc
tgagcaaatgaatcccagtgccctggggtggctgtgtttgtcaggatggcattcccagtc
cgagaggcacaatgtgtctcattcacagcatttctccttgccccttgtgtgtttggacag
ATATTTCCAGGCCTGATTCTCTCAGATATAAAACCGGCCAAAAGGATGAAGTTCAAGACT
GTCTGCTACCTGCTGGTGCAGCTCATGCACTGCCGGAAAATGTTCAAGGCCGAGATCCCC
TTCTCCAATGTCATGACCTGCGAGGACGATGACAAG
gtaggagcagccagggagcctgccatgctggagctgccagggactgatctctgtcctgcc
ctcccaatatggcccccgtgccatttggctagatcagaattccctgttcacatgtggata
atcttgtaaatgctgctcagagctgagctactttttatttcctgcaaaagtcattatagt

 3.07 Intr +  97134  97188   55  2  1   56   99    61 0.185   2.55
agtgatatcactgcatcctccagggttcttttgacattgtaggagcttcaccttcctgtc
catccctgtggccttgggctgttcctggtacattttcagagatgtgtgtatcatctactc
actgaaggacagctaccttcctctcaatgtgttggccactctcgtggatgcccgtcacag
CCCAGGACTGTGATTTATGACTGTGGAGGACAGTCAGTAACCCAGGACACAGCAG
gtgagctgacaggcagaggatgctgggtggtgacagggtttggaggtgtggctgacctga
gggtggaccaatgtctattactcctgacttgagggaggatccatgtccattagcaccaac
cggaaaatggacctgtgttcatcagccccgaccacagggaggatctgtatgcctcagtcc

 3.08 Intr +  97569  97779  211  1  1   66   76   143 0.231   8.87
tgtccatcattccgtgacctgagagtggacctgtgtccatcattccctgatccagggtgg
acctgtgtccatcattttctcacctgagggtggacctgtgcccatcagccctgaccacag
ggaggatctgtgtccctcagtccctgacttgatgttgaagggtgaacctgtgtccttcag
TCCCTGACCTGAGGGTAGACTTGTGTGGATCTGCCCCAACTGGAGGGTGGACCCATGTTC
GTCTGCCCCGACTTAAGGCTGGACATGTGTCCATCAGCCCTGACCTCAAGGTGGACCTGT
GTCCATCAACCCTTCACGTGAACTCTCAGAACTGTCAGACCAGGGAGCAGTTGGCACTGA
CCACTGGTCTTCTGAACAAGCCCAACCTCAG
gtagataaccagtgaccggcagggaactcaagtcaaggtctgcttgtttggggttgtagc
ctgaattggcaatggaaaagctgctgggcgcagcagagatttgcgctggcaaggactctg
agcatggtttcctcattatctccagcttcaggacagaggttccccttgagtatggaagtt

 3.09 Intr + 103359 103539  181  0  1   48   45    57 0.090  -2.73
attttttaaggcttgatattatgagtggtttctttttttttatgtcctagacatttgggt
attatgttgtgatactctggatcctactgaaattttttgttttagcaagtctcttcagac
tttacagcattggggcagtgtgggtggaattccgggtttcccacttatcctccatgacag
CCTGGCATTTGGCACCAAGGTGATGCCTGGCACCTTGTTACTGTTGAGTAGAATATGGAC
ATTCTGCATCCTTGTTCAGCATCCACTGACAATGCAAGTGGGAGCTCATTACCACTCAGT
GGAGATGAGCATCTCCACTCCCTGTTCAGGTTTTTCTGACACTATGTCAGTGGGGCCTTG
G
gtgtgcctcctcacagcctaataaagatcaaagtcgaggctccccacatggtctttgctg
gcctgggtggagctggggccacagattttttttttttttttttatggtctttggctacaa
tagggtggttattgtctaaaagttttgttttgctaggttgcccctttttttttctttggc

 3.10 Intr + 104656 104850  195  0  0   41  121   244 0.971  22.61
gctgctgagatgactcacctgccatctcaccaccagcagggcagagtcatgattattaaa
tgtcagattcccaaacccgaccccaccctgcagcggatctggctggagggagagtacagg
tgcttttcttcaataagtggagaatttgatgatactcctttatttccatgatggctccag
CGGAGGGCATTAAGAACAGCCTCGGAAAAACTCAGAAACCGCTCATCTTTTTCTACCAAC
GTTGTCTACACCACCCCGGGCACTCGCGTCAACAGGTACATCAGCCGCCTCTTAGAAGCC
CGCCAGACAGAGCTGGAGATGGCAGACCTGAACTTCTTTACCCTGAAGTACAAACATGTC
GAACGGGAGCAAAAG
gtaagcaactctggttttcggcttccctggtgctgcttgcgaaggcgctgcctggctgga
ggaagccctcagccctgatggattgacttctctcttacacagtaccaccagcttcaggac
gagtatttcaccagcgccgttgtcctcaccctcatcctggctgccttatttggccttgtc

 3.11 Intr + 104953 105050   98  0  2   86   79    89 0.999   6.61
gcccgccagacagagctggagatggcagacctgaacttctttaccctgaagtacaaacat
gtcgaacgggagcaaaaggtaagcaactctggttttcggcttccctggtgctgcttgcga
aggcgctgcctggctggaggaagccctcagccctgatggattgacttctctcttacacag
TACCACCAGCTTCAGGACGAGTATTTCACCAGCGCCGTTGTCCTCACCCTCATCCTGGCT
GCCTTATTTGGCCTTGTCTACCTTCTAATATTCCCACA
gtgagtatttctatcaacgaggtgaggaactcaccaagaagtcccggtttctggggttcg
tggttgtgtttctggggttcatggttgtgtttctgttgtatgctcaagcttcgtctccca
cagttattgtcccaatgtgcccaacatggctgacattagccagccatcatttcctcattt

 3.12 Intr + 106499 106583   85  2  1  123   91   118 0.990  15.42
aaaaatagaaccagccatgtcagttcccagagacctgagtggcaggcatccaggttaacg
atgctgcttcctcctgagagcacaggggatgtggagggaggggccaattctcagccatct
cttgggtccgcctctcctaatccccacctatcagtgactctcatgttttctgtcccccag
GAGTGTGGTCGTCCTGCTCCTGCTAGTATTCTGCATCTGCTTCCTGGTGGCCTGTGTCCT
GTACCTGCACATCACCCGGGTCCAG
gtatgtgggtggcctgtgtcctgtacctgcatatcacctggttcatgtatgtgagtggcc
tgtatcctgcacctgcatatcacctggtccaggtatgagggtggcctgtgtcctatacct
gcatatcaccttgttcaggtatgtgggtggcctgtgtcctgtacctgcatatcacctggt

 3.13 Intr + 108463 108540   78  0  0   57   78    47 0.544   0.35
tgggggtccagctttcctgggagtgccatcagtggtgcttgcggctgttgtggaagaagc
agagtggagactaagtgcccagacttctcagctaggacaggagaggggattcagctcaca
gccagtgtgtactgggtcagggtttgattgaatcacaagtatttaggctcctgttcgcag
GCTCTGCACCGGGCTCTGAGCATCCCTGCTGACCCTGGGCCAGGGAAGAGGCCTGTGCAA
ATGGCTGTGGGAATGGAG
gtgagggaggtttgcaggaagccagcaggggataggtcagggccacccagcagaaggcca
ttgtggcctgagtggacgcggtgggtcatgcagacggagttagttccagaacacatcctt
gagaaggccgggtagaaatgtttccctccccgacattgacagtgtccagagccagggtgc

 3.14 Intr + 112752 113005  254  2  2  130  106   178 0.998  20.03
agtggggagccttgaagtgctgtgagttgccatgaggtctgtggcttggtgtgatagcac
tgggggtgggtcagagcaaaaccttgggagacctgcttgaagagggacacctgagcatgc
ttaggggctgcaggtcttcacctgccctttgctaagcccctgtgacccctcccttcccag
GTGGGCTGCCTGCCTTGGGCCTGGAGCTCCAAGCCCAACAGTTCCCTGGTGGTCCTTTCG
TCTGGGGGCCAGCGCACAGCCCTGCCCACCCTGCCCTGCGAGTCTACACACCATGCCCTG
CTCTGCTGCCTGGTGGGCACCCTCCCGCTAGCCATATTTTTCCGGGTGTCCTCCTTGCCA
AAAATGATCCTGCTCTCCGGGCTCACCACGTCCTACATCCTCGTTCTGGAGCTCAGCGGA
TACACCAGGACTGG
gtaagtgtgtggctcctcaagaaaaaggcctaagcagcggtgctactgaatctgtgtata
cagatatgcactacaggcttctgagtccagaactagtcaagttgaattgtatacacaatt
tttagtttggtggctgcttctcttcaacccaagttctagcaaggtactcagaatttccct

 3.15 Intr + 113339 113423   85  2  1  106   43   125 0.563   9.62
ttctagcaaggtactcagaatttccctatgataagtgattcttggccaaggtcaatccca
gcaagctgtttttgggtgtcaccacctgagggtcactctgaacagttcttgggtttggtg
gcagagtcttgccctggaagctcggcactgacttggcttttcttcctcatcttcccccag
GGGTGGTGCCGTCTCCGGGCGCAGCTACGAGCCGATTGTGGCCATCCTGCTCTTCTCCTG
TGCGCTGGCCCTGCATGCCAGGCAG
gtggacatcaggctgaggctggactacctctgggccgcacaggcaagacgagccctttct
gctttctgggggtgggggatttagaggaggaagaagtcttcagcaagcatctgacggggg
ctgccacagacacccacacgccgtatggccctcggagggccctcctcagcagcatgcaag

 3.16 Intr + 123537 123704  168  2  0  101   41    45 0.003   1.24
ggctagttgttgtggaaacaagggagcttgtgctggcaacacgtgctcagggtcaggctc
tcagccctccccaggaccgttcagcttcagagtgctcccccgtaggatggcctccctcac
attctgagtgggtaaattcacagtggcctccccagctctgaggcctatgcttctccctag
ACTCTCCTGCATCTTGCAAGTAGAGTAAAAGGTCCAAAGACCCCAGAAGTTGCTTTCTGC
CCACGGAGTGGGCAGAAATGTGCACAGGCTGCTGCTGCTAATCAAGGGAGGAGAGGAGAG
GAGACTCGAGGAGTGTGGAAGACAGAATGCCATGAAGGCCCTGGGCAG
gtgttgtttgctcctcagaaaggagtaatttattctaattaaggggctgaagaggacttc
ctggaggaggtggtattggaccaggcctttcactgtggcaagaaatgctgacttttctga
aaagggtaattttggtaattccctgatttcaatgtctgacattttaccctggaaacttca

 3.17 Intr + 130164 130280  117  2  0   29   89   180 0.022  12.86
tcttccctacccagtaacatggatctagtcttgcatctagtggggaggagggacaggagc
gtggatgtagaccatcagcacacctggagtccagtttggatgattagaaggaagtgtgcg
gtgggaacaagtgaaggcagcgtgagtggatgggactaatggaggctcatgataccccag
GCAGAGGAGGAGCGAGAGGACATGGAGAAGGTGAAGCTGGACAACAGGCGCATCCTCTTC
AACCTCCTGCCGGCCCACGTCGCCCAGCACTTCCTCATGTCCAACCCTCGGAACATG
gtgagcacccagcctgctcctggccagcactagcccgacactgctctggccaccccactt
ggcgctcacctggctgacccttcctgacccatcctttgaacttccaggacctctactacc
agtcctactcccaggtgggcgtcatgtttgcctccatccccaacttcaatgacttctaca

 3.18 Intr + 130388 130534  147  1  0   95   78   409 0.993  41.03
caggcgcatcctcttcaacctcctgccggcccacgtcgcccagcacttcctcatgtccaa
ccctcggaacatggtgagcacccagcctgctcctggccagcactagcccgacactgctct
ggccaccccacttggcgctcacctggctgacccttcctgacccatcctttgaacttccag
GACCTCTACTACCAGTCCTACTCCCAGGTGGGCGTCATGTTTGCCTCCATCCCCAACTTC
AATGACTTCTACATCGAGCTGGACGGCAACAACATGGGGGTGGAGTGTCTGCGGCTTCTC
AACGAGATCATCGCCGACTTTGACGAG
gtgaggctgtgcgtcgccatcctgaccccgcctggttgtggtggtgcatcctgttgcatg
ggcagagcgtgtctcacaatatgtcacattcttcgtagctggaatgagagaaagcaaatc
ccgggaagcacaggcattctgtctcctttgggatccagaccaaccatgacaggagagaag

 3.19 Intr + 131306 131404   99  1  0   18  113   163 0.999  12.11
ctgtcctgcctcacctcttcttgccagtgtagtcctagaacttgtctgcccaaagcaaag
aagacatgttgctttcctgaatgtgtccatcggctctgctgttgctcctgggggctgacg
gctgcagcgacttttctcaaatgttatgtcatgtttaacagttttatgttttaaacaaag
CTCATGGAAAAAGACTTTTACAAGGACATAGAGAAGATCAAGACCATCGGGAGCACCTAC
ATGGCCGCTGTGGGGCTAGCGCCCACCTCGGGGACCAAG
gtgagtgcagcctggcgctgcctgcttggggactgggtccaagctctgccctaaactgct
ctgggaccctgggtagcttccacactggggtttgtttgccctctgtgttggattacagga
gcagcttgagtgctgtttttgtccgtggctggctctctccagacacaatctcctagggaa

 3.20 Intr + 135139 135253  115  0  1   75   76   252 0.999  22.72
gccaataccctgcctctctcttagtctcctacctgtagaatggaatgataaatgtgccta
tagccaggcactcagagtgccttcctctgaaagtgcagctgttgggcactgcaggttggt
ccctggccccctcttgccttgcactccccagatgtaatgaccccatctgtttacacctag
GCTAAGAAGTCCATCTCCTCCCACCTGAGCACGCTGGCGGACTTTGCCATTGAGATGTTT
GACGTTCTGGATGAAATCAACTACCAGTCTTACAACGACTTTGTCCTCCGAGTTG
gtatgtggctctaaacctatcctgtccatccatgtggaacaccttcctacacccacctag
gggtgggatcagctgatgaggtaccctggtcttacaggaaggagggtggtgccacccagg
agggcatggggacctgtgtaccgagttgcccctggaagctgctggtggaaggtgaagatg

 3.21 Intr + 137317 137441  125  2  2   73   82   156 0.920  13.80
ctctggtgctgtgtgtgatgcttcaggaaggagcctggtgctaggtgaccccaggaaaca
aagccctgaaaggagcagccttttctccaccaggagcagcatcaggtgcatttggtggcc
ctggtggggtgagttacacttttcccgctgatgacaggtcatgcgctggctgttttctag
GCATCAATGTTGGCCCTGTGGTGGCTGGAGTGATTGGCGCTCGCAGGCCCCAGTACGACA
TCTGGGGAAACACAGTCAACGTGGCCAGTCGGATGGATAGCACAGGGGTCCAGGGCAGAA
TCCAG
gtcagttcaccaagaaacccctaaggcatgggtgcccattcttcaggtgaggaaactgag
gcacagggggccagaattgaatccccagtctacagcccgtaagtggcagggcagaaagag
ctgcatatttcggtctgtctgctctggagggcatcctggcccgggcatcttgattttgct

 3.22 Intr + 140482 140688  207  0  0  108    7   121 0.450   5.27
agtgatttcagcaagagtaggggccctggctgccaggctgagctgggaaagccacatccc
agtgccagggttgggcagtcagggtggacagcaacagatgcaggatggagtgttttggtc
tcttcccagaggagtccccctcattgccctgaagtaacactcacttctctccatcaacag
GTGACTGAGGAAGTCCACCGGCTGCTGAGAAGGTGCCCCTACCACTTTGTGTGCCGAGGC
AAAGTCAGTGTCAAGGGCAAAGGCGAGATGTTGACATACTTTCTAGAAGGCAGGACTGAT
GGAAACGGCTCCCAAATCAGGTCCCTGGGCTTGGATCGGAAAATGTGTCCATTTGGGAGA
GCTGGCCTTCAGGGCAGACGTCCCCCC
gtgtgccccatgcctggcgtctcagtcagggctgggctccctccacactccccaggccag
tacctgccctctgcagcagctgggaaggaggcttagtggagcccacgtgggcctctgggg
tgcacatggggtgggaatgctccgggggtgacacaggccacggtggctccagccaggacc

 3.23 Intr + 141700 141835  136  0  1   14   72   115 0.686   2.64
aaccatggccagcatcggcttcttgctgcacctgtgcattctccacccctccgccaatgg
cttccagctcctaaaacacctggacattccccatcctgcaccggcactgtgtttgttcag
agaaaacgaagggtgtcatttcttcttttccctgtggcatcgtggatcctttacatttag
CAACAACAGTGTGAGGCTCCACTTCTGTTGAATATGAGCGGCTGTCACACCCATGAGCAA
GTTTCCTTGATGGAAGATGCTGTTTCTCCGGCAGAACCAACCCTCCAGGACGAAGTTTCA
GAATTGGCTGATGGTC
gtgagtgcaggtgtccctgttgtaatttgcagggaaattgactgcaggtgatagtgttga
cgtctgacgtctgacaacctcctatgtgcatgtctaaatagtcacaatgaagatgaaaat
aaggatgatggggacggggtccaggagggccactgggaaggcactatccagaaatagtgg

 3.24 Intr + 143328 143438  111  1  0   70   52    85 0.268   3.45
tgtgctttcctctcttcaggacaaatggtttgtccttatggtcccctttccactaggatt
ttctcatcctcatctgtctatcccagccggatttaaagcagtcacttcagacaggagcca
cagggagcctgtgagggagtagtgcggtggtggtgagtgtggctgccctggctcccccag
CTCACCGTGGTGCTGTCCTTGACCCACGAGCTGTTGAGAAGGGTGCAGAGCCCCTGGCAC
AGCCAACCCTGTTGCCCCCAGTGCCGCTGCCCAGCTTCGGCCATCCAGGTG
gtgggtagacagaggagtgaaccccaaaggtgtccatgccccagttctaagccctgtggc
caggctgctgtcacacagcaaaggggactttgcaggtggaattagggttagggatctaag
gatgggaggggaacttggtttatctgggtggctcagtgaccccttggaatggctgaggga

 3.25 Term + 149491 149567   77  2  2   42   55    72 0.086  -2.70
ccatcctcatttatactgattgcacaccccccgctcaaacaacaatgtccttattatgat
gaccatctcgtagtggtacattccattcctatttaaggtaagcccaaagcccacttttgg
attttctcgactgtccgagaaaagttgtgtaagcgcctgcgttcttctgggtttggctag
ATAGGGTTGTGTCCCTCTATGGAATGGAGAGTGATGTGGGCAAGGGTGTCATTTTCTCGC
ACAATACAACTCACTGA
ggatgcttctgtagaagtgagaaacacgatgagtacattcagaattacaataactcactc
tcactgggtaacttctcatgatagatttgtatgatcaatacgggtctatttttatgtcaa
ctgaacactgtagggtaccttccagtctttttcaagattgttaaattgagacaagtaatt

Predicted peptide sequence(s):


>ADCY1_1|GENSCAN_predicted_peptide_1|482_aa
MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQR
KAFLQARSCIEDRLRLEDENEKQADGDSFMLVHLLYFFVISTLQPSVPLHSDFPGSRVNF
SLYNRDTDASSPRFPRVWAEKKVKCCNIAEEDAGAGCRLGLWEALRHVLGGCEEERLLMS
LLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLN
ELFGKFDELATAVATLALSRLRAGVLKDLPWTSHIWQPSSAECRAKAIPTALACNVHVRK
QR

>ADCY1_1|GENSCAN_predicted_peptide_2|256_aa
MAKENKKGNKEQMRQKANGKDTHYHLVTASQTCACSADASPHEWILEPVYSYGEGTAASF
LSAVLLVGTWSSQLAEFKGCMKASCSCNDILTSASTVSPATQKQRPQEQRRPAAQPGGST
GLTPRTLHRPEANTSATAQLLGRHMANTGRMDVFKRNTVWTKVLISGLPGRQSDARSGGP
SISSKHGEREKAQVGPSGTLQKKVPKMTSFLLKGWEARSRPRTQYWLHSPGDKPSGQPRQ
DCKGIADQKLQCPAER

>ADCY1_1|GENSCAN_predicted_peptide_3|1103_aa
MSEENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRV
GLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGPGHAAAVFIADGMDEASAEHR
NAQTLAFLETVVTGSFQTASVTVVVQGQADGGDSVPRKVHITKTTLACLNGDYEVEPGYG
HERNSFLKTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFK
AEIPFSNVMTCEDDDKPRTVIYDCGGQSVTQDTAVPDLRVDLCGSAPTGGWTHVRLPRLK
AGHVSISPDLKVDLCPSTLHVNSQNCQTREQLALTTGLLNKPNLSLAFGTKVMPGTLLLL
SRIWTFCILVQHPLTMQVGAHYHSVEMSISTPCSGFSDTMSVGPWRRALRTASEKLRNRS
SFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKYHQLQDEYFT
SAVVLTLILAALFGLVYLLIFPQSVVVLLLLVFCICFLVACVLYLHITRVQALHRALSIP
ADPGPGKRPVQMAVGMEVGCLPWAWSSKPNSSLVVLSSGGQRTALPTLPCESTHHALLCC
LVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAVSGRSYEPIVAILLF
SCALALHARQTLLHLASRVKGPKTPEVAFCPRSGQKCAQAAAANQGRRGEETRGVWKTEC
HEGPGQAEEEREDMEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFA
SIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKDFYKDIEKIKTIGSTYMAAVGL
APTSGTKAKKSISSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGAR
RPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTY
FLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRRPPQQQCEAPLLLNMSGCHTHEQVSLM
EDAVSPAEPTLQDEVSELADGPHRGAVLDPRAVEKGAEPLAQPTLLPPVPLPSFGHPGDR
VVSLYGMESDVGKGVIFSHNTTH