GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:27:21

Sequence TCF19_1 : 5655 bp : 52.52% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    102    284  183  1  0   48   49   135 0.830   5.88
gtcctatttcactctgttgggaggagggggaaaggtgtacgcaggcgcagtggcgtctaa
atttgggcccactaaatgcgtcggagcatctccgcgcccagGCGGCTCCTCCTCACTGCGGCAACCCGGGAAAACTTGTGAACTAATCAGAAAAAGTGGAA
GGCGGGAGATCTTGGGGCGCTGTCCAATGGCGCGGAAGAGAACAAATGAGCTGGCCAATC
GGGAACGGCACGGGGGCGGGCTCGCTCGGCGCGAAGTTCGGGCCCGGGAATTCCGAAGGA
GGG
gtaggcgctgcccgcgcgcagaggccgcgcccctcctggccccggcttcttggctgtcaa
acagatgcagcaacgtcggctcctgccgaggagcccaaggggtcccgggatccgccgcac
aggctggcactgcttgaagaggaggctactcggagactgcgccgcgcgggtagatccgaa

 1.02 Intr +   1232   1438  207  0  0   64  105   144 0.887  13.27
gtagtgtgctcaaagttgaaaccgcatacagcacaactcaagtttgcatcagactgggaa
gcgaacttaagccagcggtgcgtggcccaggagtgggaaaggaaatggatgcctgaagtg
gaagaggtggtgcagagggggcaccgcccatgctgccctgcttccaactgctgcgcatag
GGGGCGGCAGGGGCGGTGATCTCTACACCTTCCACCCCCCCGCCGGGGCTGGCTGCACCT
ATCGCTTGGGCCACAGGGCCGACCTGTGTGATGTGGCCCTGCGGCCCCAGCAGGAGCCTG
GCCTCATCTCTGGGATCCACGCCGAACTGCATGCCGAGCCCCGGGGTGATGACTGGAGGG
TCAGCCTGGAAGACCACAGCAGCCAAG
gtgagcattaagcagggcagctttgcccctgggtggttgaagcgccaggctggaatgagt
aaggtctccacaagaccctgctgcctgcctcccatactcccatcagattggatggatagt
cgtggtccagaccttcatcttcccaccagaagtgtgcacagtcagaagctctctgccaga

 1.03 Intr +   3143   3701  559  0  1   73  106   256 0.877  18.39
cctagctgacaaggagtgtactgcctggtacctgtcacctgctgaggggcttaggatgtg
agggagaatctgactacagtttcatattcttccccagaaatcatacagatttctccactc
ctgactctggtcatttctgtttttgtcctccatatttgcctggtgccccaccatcaacag
GTACTTTGGTCAATAATGTCCGACTCCCAAGAGGTCACAGGCTGGAATTGAGTGATGGAG
ACCTCCTGACCTTTGGCCCTGAAGGGCCCCCAGGAACCAGCCCCTCGGAGTTCTACTTCA
TGTTCCAACAAGTACGAGTCAAGCCTCAGGACTTTGCTGCCATTACCATCCCACGGTCTA
GGGGAGAAGCCCGGGTTGGGGCTGGTTTCCGGCCTATGCTGCCCTCCCAGGGGGCTCCAC
AGCGGCCTCTCAGCACCTTCTCCCCTGCCCCCAAGGCCACACTGATCCTAAACTCCATAG
GCAGCCTCAGCAAGCTCCGGCCCCAGCCCCTCACCTTCTCCCCTAGTTGGGGTGGACCAA
AGAGCCTGCCTGTTCCCGCCCCACCTGGGGAAGTGGGGACCACGCCTTCTGCTCCACCCC
AACGCAATCGGAGGAAATCTGTTCACCGAGTGTTGGCGGAACTGGATGATGAGAGTGAGC
CTCCTGAGAACCCGCCACCGGTCCTTATGGAGCCCAGGAAGAAACTCCGTGTAGACAAAG
CCCCACTGACTCCCACTGG
gtaagtggagtcctcacttggccctctcagtgttttactgcttttcgattccttgtatcc
ctaggctgtgaggaggtccccctgcctggggggatgggcacgggaggtggaatagatgga
atggcaagacctgggttagctctgataggaaaagaaaaatatgtgcaggagaacatgaga

 1.04 Intr +   4135   4202   68  1  2   45   55   111 0.774   2.54
cccattcttctagtgcctaaggatggggaactttcaggctcacactagaggtttttaggc
ccaccctatgtgtttttaaggacagagtccaggctcaccttagttctcagaccactgtgc
ctctgtggcctcaccctatgaccagccatagggtggcaaggtctaggccttctcctacag
GTTTCCGGTGACCCTTGTGTCTGTGTCACTTCCTTCAGAAATCGACGTGGCGTCCTCGGA
AGTACCCA
gtgagcgctcccatggctccccctgcagttgggggcggggagccctgtgcagctccttgt
tgctgcctgccccaggaagagacagtggcctgggttcagtgtgatggctgtgacgtctgg
ttccatgtggcctgtgttggctgcagcatccaggctgccagggaggccgacttccgatgc

 1.05 Term +   4231   4412  182  2  2   55   45    87 0.611  -0.81
accttagttctcagaccactgtgcctctgtggcctcaccctatgaccagccatagggtgg
caaggtctaggccttctcctacaggtttccggtgacccttgtgtctgtgtcacttccttc
agaaatcgacgtggcgtcctcggaagtacccagtgagcgctcccatggctccccctgcag
TTGGGGGCGGGGAGCCCTGTGCAGCTCCTTGTTGCTGCCTGCCCCAGGAAGAGACAGTGG
CCTGGGTTCAGTGTGATGGCTGTGACGTCTGGTTCCATGTGGCCTGTGTTGGCTGCAGCA
TCCAGGCTGCCAGGGAGGCCGACTTCCGATGCCCAGGGTGCCGGGCTGGCATTCAGACCT
AA
ggtccaccgccaaggcaccatcggacacacctgcccatgagtagacacagcagcgagcaa
ataggtctgataaataccccccttcccttccctccccaagagggaatgactacagggaag
aaggatggattgatgtggactcattcagggcctggagcagaccctggtggccaagacaga

Predicted peptide sequence(s):


>TCF19_1|GENSCAN_predicted_peptide_1|399_aa
XGSSSLRQPGKTCELIRKSGRREILGRCPMARKRTNELANRERHGGGLARREVRAREFRR
RGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDW
RVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFMFQQVRVKPQ
DFAAITIPRSRGEARVGAGFRPMLPSQGAPQRPLSTFSPAPKATLILNSIGSLSKLRPQP
LTFSPSWGGPKSLPVPAPPGEVGTTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLM
EPRKKLRVDKAPLTPTGFPVTLVSVSLPSEIDVASSEVPIGGGEPCAAPCCCLPQEETVA
WVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT