GENSCAN 1.0	Date run: 16-Jan-104	Time: 14:31:04

Sequence TBX18_1 : 29896 bp : 37.99% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1492  292  0  1   84  100   460 0.992  42.16
gatcccaacacaagcgagaaagcggaaacgccaaatctgttttttgcccgcggtggggaa
gggggcagatctcgggaggccccgagagccttttagtttttggtgggggaagagcgagag
cgcgcgtgtgcccgcgtgagtgtatatgagagaggggcgggcgggcgcggggcggggggg
ATGGCCGAGAAGCGAAGGGGCTCGCCGTGCAGCATGCTAAGCCTCAAGGCGCACGCTTTC
TCGGTGGAGGCGCTGATCGGCGCCGAGAAGCAGCAACAGCTTCAGAAGAAGCGGCGAAAA
CTGGGCGCCGAAGAGGCGGCGGGGGCCGTGGACGACGGAGGCTGCAGCCGCGGCGGCGGC
GCGGGCGAAAAGGGTTCTTCTGAGGGAGACGAAGGCGCTGCGCTCCCGCCGCCGGCTGGG
GCGACGTCTGGGCCGGCTCGGAGTGGCGCAGACCTGGAGCGCGGAGCCGCGG
gtgagtgggccccttcctgcctataacttctctccggcgcgaacctgaacttctgcgagt
ctgtgggtgtgcgtgcgcgccgcgtccctacatggccaaggccactcagccactagcgca
ttggccgtgtcagtcgcaaagctcgccgcgcaacctggtcaccctccagacggttcagat

 1.02 Intr +   2634   2838  205  1  1   96   95   202 0.982  19.04
acaggcagaatgtgggtgtctatcgactggcttgttctttaggaggacctgatggcacca
aagcttccccttttctcccggtcattttcctcttctcagccaccaggtgggcccgtctcc
gcggctggcttcccctctgtttccctcaccagttccctttctctgtcctttgctgtccag
GCGGCTGTGAGGACGGCTTCCAGCAGGGAGCTTCCCCTCTGGCGTCACCGGGAGGCTCCC
CCAAGGGGTCTCCGGCGCGCTCCCTGGCCCGGCCCGGGACCCCTCTGCCCTCGCCGCAGG
CCCCGCGGGTGGATCTGCAGGGAGCCGAGCTCTGGAAGCGCTTTCATGAGATAGGCACTG
AGATGATCATCACCAAGGCCGGCAG
gtaatgggcaagctggcgtggacgcccctccctaccccagaccctgtcttcactcacctc
tagctcaatcaggaagaagggcctgcagctcggtgggggttctggatagcattttcggtc
aaacgggaccaggccccagaccgtggttcactttggaggctagctttggctacccaccac

 1.03 Term +   2879   3134  256  2  1   63   32   220 0.951   7.97
gggtctccggcgcgctccctggcccggcccgggacccctctgccctcgccgcaggccccg
cgggtggatctgcagggagccgagctctggaagcgctttcatgagataggcactgagatg
atcatcaccaaggccggcaggtaatgggcaagctggcgtggacgcccctccctaccccag
ACCCTGTCTTCACTCACCTCTAGCTCAATCAGGAAGAAGGGCCTGCAGCTCGGTGGGGGT
TCTGGATAGCATTTTCGGTCAAACGGGACCAGGCCCCAGACCGTGGTTCACTTTGGAGGC
TAGCTTTGGCTACCCACCACTAGTGCAGTCGGTGCACAGTCCAACTGCCCTCTGGTTGAA
TGCCAGGGAGAAAATTACTGTCGCCGCTGATGCCACAGCTGTCGCGGTTGATGTTCTGCG
TTCAGGGCGGTTATAA
atttgaggtcatatttacccttgtccaggtatttatttaggctctagttgtcagttctgg
aactaggaaacattcttttttttttcctttctcttttatttttaaacagcagtttactcc
agtaaactatgatttgctttttcagatttgaaactcccaggcagattggttctttatcag

 2.01 Init +   5042   5127   86  1  2   60   92    86 0.934   6.54
atatgttctatgtcctgactccttgaattacattggcaaagtgaatactataaatttatc
catattaaaaatagagatccaagaggtttctttgcttattcacgctccatccttagtcac
aaacaaaaaccccaaaccctctttctcttcgcctttttaaataggcgcatgtttccagca
ATGAGAGTGAAGATCTCTGGATTAGATCCTCACCAGCAATATTACATTGCCATGGATATT
GTACCAGTGGACAACAAAAGATACAG
gtacagtgattagatactgaacaattaaaaaaaaaaacactaggattttgcaggctagtg
cctgtttgatctgtgaggactgtgatctttgcttccagaagtctgtagaatttccagatc
catactttaacgcccatgggtgccagcggcccagatggtgccttttcttgcggcaaatgt

 2.02 Intr +   8513   8684  172  2  1   89   84   114 0.877  10.12
gtaggccactgctgcctcagagtggtttggaaaagcgcttgaaattttatttttagtgta
aagaggaaattgatttattttaaaactgaaacaaaataggcacacattttgtctgattct
actgagttggacatgccaagataaaaacagtatactgaacgcctggtcattgccttctag
GTATGTTTACCACAGTTCGAAATGGATGGTGGCAGGTAATGCTGACTCGCCTGTGCCACC
CCGTGTGTACATTCATCCAGACTCGCCTGCCTCGGGGGAGACTTGGATGAGACAAGTTAT
CAGCTTCGACAAGCTGAAGCTCACCAACAATGAACTGGATGACCAAGGCCAT
gtgagtagatggcctctctaatgcatctgtagatggcacagccacatctacactgtgcct
gactaaaggaaatgaatgcttctaagatcataatgttcattgcctgattgattagtatgt
acactgtctttgcagaatcaagtttatatttgcatagactgtgcctgttgccagaattat

 2.03 Intr +  17295  17462  168  2  0   68   72   157 0.983  11.32
ttttacaaacaacttcttagccttccttctccagttctgatatttcttattaaattgaca
cctctgcatccttggaaatgatttccaatcagaattgattgtacacattaaatatttagt
caggttgttgaggttgggcagaggcttctgataaattcagcttttccttctttgatatag
ATTATTCTTCATTCTATGCACAAATACCAACCGCGAGTGCACGTCATCCGTAAAGACTGT
GGAGACGATCTTTCTCCCATCAAGCCTGTTCCATCCGGGGAGGGAGTAAAGGCATTCTCC
TTTCCAGAAACTGTCTTCACAACCGTCACTGCCTATCAGAATCAGCAG
gtattgttctcagaattggaatctttgtagatttttcatttcaggtgaagagagaaagtt
agctatccttctcactctaaatattatgaattataaagcatttgccatatatgacattca
aagtgtatatatatgaataacagttctttatccatgattttccaagtaagtctgctctaa

 2.04 Intr +  21057  21121   65  2  2   95   80    59 0.973   2.40
atgatttctgaaattttccttagctttactgctaggatattaaaatacttggggaataaa
agaggcttatacaatagagtcctctaacagttaacttttgactcattgtagttttgcaac
caagtaaaaacttgcttgacatttatataagatttgatatttttttttcctactctgcag
ATTACTCGCCTGAAGATAGATAGGAATCCATTTGCTAAAGGCTTCCGAGACTCCGGGCGC
AACAG
gtgggccttagtgaagaccattccggttatgataaatatatttgatattttattatgaat
tttctattacaaagtaaatggctaaatttactaatacgatattgaaatcatttctgatga
ggactgttgtgcctcggagataacttatttttgtagtgtaatggtgtcacctaccctaag

 2.05 Intr +  26791  26885   95  1  2   67   88   118 0.960   8.39
taacaggatgttagcccattgctgaagcatttcttcttgccagtggcaagatcctaactg
gacagtgtgggggtactgtcaatatcagtgttgttttgagatgcttgctgctggtgaaag
atccaaatgctcctaactagacttcttttgtccacccctatcctgaccctttccatttag
AATGGGTTTGGAAGCCTTGGTGGAATCATATGCATTCTGGCGACCATCACTACGGACTCT
GACCTTTGAAGATATCCCTGGAATTCCCAAGCAAG
gtaactcacaaagtctcctgggtcatatatacagcccgttcctgcctagaaactcaggca
ctaaaagtgtacaagtcattatttatacttacaataatgacctcatcaccagcattgtcc
tacagattccatctgtcttctgcatggtatggggatggatcaggaaaaaacggctctcat

 2.06 Term +  27973  28697  725  2  2   78   45   442 0.919  31.55
taattggaaatgagatttttcaaccagataattccttgaaagctgagaccatctcctttt
catctctgtagcattcctccaacccttgccttgtaacaagctgtgtctagctcatattta
caaaattgaaaggaaaggatgactgtggagtcattctttacatttcaacttcttttgtag
GCAATGCAAGTTCCTCCACCTTGCTCCAAGGTACTGGGAATGGCGTTCCTGCCACTCACC
CTCACCTTTTGTCTGGCTCCTCTTGCTCCTCTCCTGCCTTCCATCTGGGGCCCAACACCA
GCCAGCTGTGTAGTCTGGCCCCTGCTGACTATTCTGCCTGTGCCCGCTCAGGCCTCACCC
TCAACCGATACAGCACATCTTTGGCAGAGACCTACAACAGGCTCACCAACCAGGCTGGTG
AGACCTTTGCCCCGCCCAGGACTCCCTCCTATGTGGGCGTGAGCAGCAGCACCTCCGTGA
ACATGTCCATGGGTGGCACTGATGGGGACACCTTCAGCTGCCCACAGACCAGCTTATCCA
TGCAGATTTCGGGAATGTCCCCCCAGCTCCAGTATATCATGCCATCACCCTCCAGCAATG
CCTTCGCCACTAACCAGACCCATCAGGGTTCCTATAATACTTTTAGATTACACAGCCCCT
GTGCACTATATGGATATAACTTCTCCACATCCCCCAAACTGGCTGCCAGTCCTGAGAAAA
TTGTTTCTTCCCAAGGAAGTTTCTTGGGGTCCTCACCGAGTGGGACCATGACGGATCGGC
AGATGTTGCCCCCTGTGGAAGGAGTGCACCTGCTTAGCAGTGGGGGTCAGCAGAGTTTCT
TTGACTCTAGGACCCTAGGAAGCTTAACTCTGTCATCATCTCAAGTATCTGCACATATGG
TCTGA
tgaagcctttaagttaaatgacatttggatctgtctaacatattttctttttctttttta
aaagctatgtggaaagaaactctctgtggtttataaaatgtacatataatagaaaatgaa
ggctcactgggttttttgactttatcatggtgagattgtaattatctatggtatatatgt

Predicted peptide sequence(s):


>TBX18_1|GENSCAN_predicted_peptide_1|250_aa
MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGG
AGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKG
SPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRPCLHSPLAQSGRRA
CSSVGVLDSIFGQTGPGPRPWFTLEASFGYPPLVQSVHSPTALWLNAREKITVAADATAV
AVDVLRSGRL

>TBX18_1|GENSCAN_predicted_peptide_2|436_aa
MRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPAS
GETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGE
GVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPS
LRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCS
LAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMG
GTDGDTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYG
YNFSTSPKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRT
LGSLTLSSSQVSAHMV