GENSCAN 1.0	Date run: 16-Jan-104	Time: 16:30:34

Sequence PRDM1_1 : 23588 bp : 41.82% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1376   1476  101  0  2   12   87   110 0.350   2.21
gggaggggaagccagacggttaacacagacaaagtgctgccgtgacactcggccctccag
tgttgcggagaggcaagagcagcgaccgcggcacctgtccgcccggagctgggacgcggg
cgcccgggcggccggacgaagcgaggagggaccgccgaggtgcgcgtctgtgcggctcag
CCTGGCGGGGGACGCGGGGAGAATGTGGACTGGGTAGAGATGAACGAGACTTTTCTCAGA
TGTTGGATATTTGCTTGGAAAAACGTGTGGGTACGACCTTG
gtaaggaacttgaattttttttttttaattctgaaattgatctgaaaactttattttctt
ttcctttattgttattattattaattttttttggctaatgtcgcagtagaaacatgcttc
tgctttagtgcacttagtgctgtcaaacatttgtgagactttccttatgaatcattaacc

 1.02 Intr +   3082   3330  249  0  0  110   99   258 0.847  25.81
aaccttgcttcttttcaaggcagtttactttatacggcttcttggctctttctcaactgt
accaagcactctgcatctgcttttaaagtcttcagactactgtattagtcatagcctctc
agaaggagccacaggaacggcgggacaatggggattaaaggcctttcctttctcttccag
GCTGCCCCCAAGTGTAACTCCAGCACTGTGAGGTTTCAGGGATTGGCAGAGGGGACCAAG
GGGACCATGAAAATGGACATGGAGGATGCGGATATGACTCTGTGGACAGAGGCTGAGTTT
GAAGAGAAGTGTACATACATTGTGAACGACCACCCCTGGGATTCTGGTGCTGATGGCGGT
ACTTCGGTTCAGGCGGAGGCATCCTTACCAAGGAATCTGCTTTTCAAGTATGCCACCAAC
AGTGAAGAG
gtaagcctctggtttattgacaagaagattggggacctggtgccaaatctccctacttgc
ccttgaggccttgtatatctctgaaaacctctgagaatctgtaagtatcagtaaataatt
gattgctctattcaattcttgcattgctttctctttccctaaaccatttccttctcattt

 1.03 Intr +  10496  10615  120  1  0   97  110   106 0.995  13.47
gatggtctccccctatggtgaagcttgttaattatgtaggcatcattaatgtctgtttac
ttatcaaaattttatcattgttagttgtattactacttgacagtccaatttatttaattg
aaaagattggttaacattttatagtcaaagtaattgtttcctgtgttttttcctgtttag
GTTATTGGAGTGATGAGTAAAGAATACATACCAAAGGGCACACGTTTTGGACCCCTAATA
GGTGAAATCTACACCAATGACACAGTTCCTAAGAACGCCAACAGGAAATATTTTTGGAGG

gtaagtaagggaaatttcttcagacccattaaatgttaggaaaaaatggagctaaaagag
ctgggtggctcacctttctcatcctgtgctgagaaatgctggggctcacccataagtatc
cagcatccccatggacacagggaattctgaacaaatgtgatgaaaccgatgaaatgtctg

 1.04 Intr +  13460  13561  102  1  0   49   72   100 0.919   3.95
tatccagaagtagtattactctaggacaaacttcaaattcttcattctgcgttgccttta
aggaacaacatactttcttcctgttctttttccaaaaacacacgcctatggctctgtgtg
tggtgttttagccagcctcctcccagataaggggttcccttccctcctttgcattgaaag
GAAAGTGCAAGTCTGGACATGTTTATCAAGAGGAAAAGTGACTTCTCAGTAATAGACTGT
CAAATTCGGGCTGCTGCCCGAGTGTTCGCTTTGTTATGGCAG
gtgaagttcacctttgccccacccagtgtttccacaaaaaggcaaggttccaagtattca
tatgaacaagtgttactttaggacttggagggttgggggtggaggatgtttgcatagttg
aagccttgggcgggggtgtaggaaacggcgagtacagaggccatagaaaaagctaagact

 1.05 Intr +  14181  14433  253  2  1   87   89   356 0.989  31.68
tgtttccgccctgatttctgctgattcaagactattctggctaaactgattggattcttt
ttctaactaggcagtaggggatcagaaatcacacacggtaccggctgtgtttattctgag
aggtgctggggagctttgggtctgacttccttttacatgcctgtcttctcttttggacag
ATCTATTCCAGAGGGGAGCTTCACCACTTCATTGACGGCTTTAATGAAGAGAAAAGCAAC
TGGATGCGCTATGTGAATCCAGCACACTCTCCCCGGGAGCAAAACCTGGCTGCGTGTCAG
AACGGGATGAACATCTACTTCTACACCATTAAGCCCATCCCTGCCAACCAGGAACTTCTT
GTGTGGTATTGTCGGGACTTTGCAGAAAGGCTTCACTACCCTTATCCCGGAGAGCTGACA
ATGATGAATCTCA
gtaagtggattacagaacaaaaaaataaaaaatgccagtaatgtcggttctgcccctttg
aactaataacatgttgtttaattatacggctttgtcatgtgttggatgaagtaggtggct
taagctagggactaggaagaggaaaaacattttttgagtccctattaactattaggaaac

 1.06 Intr +  19706  20814 1109  0  2  103  102  1132 0.897 104.70
ctgcacttttgagtgagtggcccagagccttctagaatgagagtgcgttggaagccagat
atgtggcgattgtgtcgccagctgttactcaggttttctcaagaaggaggagcaactttg
gcagttttgcttcagttctctctagccctctgtgtaatcgcccctttttctttatttcag
CACAAACACAGAGCAGTCTAAAGCAACCGAGCACTGAGAAAAATGAACTCTGCCCAAAGA
ATGTCCCAAAGAGAGAGTACAGCGTGAAAGAAATCCTAAAATTGGACTCCAACCCCTCCA
AAGGAAAGGACCTCTACCGTTCTAACATTTCACCCCTCACATCAGAAAAGGACCTCGATG
ACTTTAGAAGACGTGGGAGCCCCGAAATGCCCTTCTACCCTCGGGTCGTTTACCCCATCC
GGGCCCCTCTGCCAGAAGACTTTTTGAAAGCTTCCCTGGCCTACGGGATCGAGAGACCCA
CGTACATCACTCGCTCCCCCATTCCATCCTCCACCACTCCAAGCCCCTCTGCAAGAAGCA
GCCCCGACCAAAGCCTCAAGAGCTCCAGCCCTCACAGCAGCCCTGGGAATACGGTGTCCC
CTGTGGGCCCCGGCTCTCAAGAGCACCGGGACTCCTACGCTTACTTGAACGCGTCCTACG
GCACGGAAGGTTTGGGCTCCTACCCTGGCTACGCACCCCTGCCCCACCTCCCGCCAGCTT
TCATCCCCTCGTACAACGCTCACTACCCCAAGTTCCTCTTGCCCCCCTACGGCATGAATT
GTAATGGCCTGAGCGCTGTGAGCAGCATGAATGGCATCAACAACTTTGGCCTCTTCCCGA
GGCTGTGCCCTGTCTACAGCAATCTCCTCGGTGGGGGCAGCCTGCCCCACCCCATGCTCA
ACCCCACTTCTCTCCCGAGCTCGCTGCCCTCAGATGGAGCCCGGAGGTTGCTCCAGCCGG
AGCATCCCAGGGAGGTGCTTGTCCCGGCGCCCCACAGTGCCTTCTCCTTTACCGGGGCCG
CCGCCAGCATGAAGGACAAGGCCTGTAGCCCCACAAGCGGGTCTCCCACGGCGGGAACAG
CCGCCACGGCAGAACATGTGGTGCAGCCCAAAGCTACCTCAGCAGCGATGGCAGCCCCCA
GCAGCGACGAAGCCATGAATCTCATTAAAAACAAAAGAAACATGACCGGCTACAAGACCC
TTCCCTACCCGCTGAAGAAGCAGAACGGCAAGATCAAGTACGAATGCAACGTTTGCGCCA
AGACTTTCGGCCAGCTCTCCAATCTGAAG
gtaggccttgagagagagcagtccaaggggctgtgagtgcatgcttgtgtttgtatttag
cttgctttccatggggtatcgattgcatttgcagtagtatgagcccccggttggggatag
tgggtatggattccgcctggcttttgccacttctagctctttgactttggacaagtgact

 1.07 Intr +  21252  21380  129  2  0   54   85   112 0.864   7.47
gcctgtgatttttgtgcttttaagaaaaacaccattctgaaaacatgaagatttcttctt
tttaagactgtcttgatgcttttcttaagatatttgcatcaacacttgagtcttggagca
gaaatgttaggtctcagagccagcttgagagcagagctaacacatgtggcttcttcccag
GTCCACCTGAGAGTGCACAGTGGAGAACGGCCTTTCAAATGTCAGACTTGCAACAAGGGC
TTTACTCAGCTCGCCCACCTGCAGAAACACTACCTGGTACACACGGGAGAAAAGCCACAT
GAATGCCAG
gtgcgcagtattttctgggtagaccttctgacctttgtagaaaatgtctgtgagtcaccc
tcccatgtcctatatagcccgtagttaaagccaacaccagattctgcgttgtcccatcct
ggactgatggcactatggtccttcccagtactttgtatctgctgatgacttgagatggca

 1.08 Term +  21792  22367  576  2  0   99   44   499 0.999  40.08
gtgtgctgtgtgcccacatccccccgtttgcttaataccacactggaggtgccacaagga
ggcttctcacctcctaggttgctgggcgttggccggtaagcctgcccctcccgttggcaa
ctcttaatcttctggccttcctgtctcccttccctgctgtctctctcccctacactgtag
GTCTGCCACAAGAGATTTAGCAGCACCAGCAATCTCAAGACCCACCTGCGACTCCATTCT
GGAGAGAAACCATACCAATGCAAGGTGTGCCCTGCCAAGTTCACCCAGTTTGTGCACCTG
AAACTGCACAAGCGTCTGCACACCCGGGAGCGGCCCCACAAGTGCTCCCAGTGCCACAAG
AACTACATCCATCTCTGTAGCCTCAAGGTTCACCTGAAAGGGAACTGCGCTGCGGCCCCG
GCGCCTGGGCTGCCCTTGGAAGATCTGACCCGAATCAATGAAGAAATCGAGAAGTTTGAC
ATCAGTGACAATGCTGACCGGCTCGAGGACGTGGAGGATGACATCAGTGTGATCTCTGTA
GTGGAGAAGGAAATTCTGGCCGTGGTCAGAAAAGAGAAAGAAGAAACTGGCCTGAAAGTG
TCTTTGCAAAGAAACATGGGGAATGGACTCCTCTCCTCAGGGTGCAGCCTTTATGAGTCA
TCAGATCTACCCCTCATGAAGTTGCCTCCCAGCAACCCACTACCTCTGGTACCTGTAAAG
GTCAAACAAGAAACAGTTGAACCAATGGATCCTTAA
gattttcagaaaacacttattttgtttcttaagttatgacttggtgagtcagggtgcctg
taggaagtggcttgtacataatcccagctctgcaaagctctctcgacagcaaatggtttc
ccctcacctctggaattaaagaaggaactccaaagttactgaaatctcagggcatgaaca

Predicted peptide sequence(s):


>PRDM1_1|GENSCAN_predicted_peptide_1|879_aa
XWRGTRGECGLGRDERDFSQMLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMD
MEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIG
VMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRESASLDMFIKRKSDFSVIDCQIR
AAARVFALLWQIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYT
IKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQSSLKQPSTEKNELCPKNVPKR
EYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRRGSPEMPFYPRVVYPIRAPLP
EDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVGPG
SQEHRDSYAYLNASYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGMNCNGLS
AVSSMNGINNFGLFPRLCPVYSNLLGGGSLPHPMLNPTSLPSSLPSDGARRLLQPEHPRE
VLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHVVQPKATSAAMAAPSSDEA
MNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQ
TCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPA
KFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRI
NEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLS
SGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP