GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:27:25

Sequence POU5F1_1 : 4333 bp : 47.96% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1422   1542  121  2  1   38   60   101 0.405   2.37
ggtgaatgacatttgtgggtaggttatttctagaagttaggtgggcagcttggaaggcag
atgcacttctacagactattccttggggccacacgtaggttcttgaatcccgaatggaaa
ggggagattgataactggtgtgtttatgttcttacaagtcttctgccttttaaaatccag
TCCCAGGACATCAAAGCTCTGCAGAAAGAACTCGAGCAATTTGCCAAGCTCCTGAAGCAG
AAGAGGATCACCCTGGGATATACACAGGCCGATGTGGGGCTCACCCTGGGGGTTCTATTT
G
gtgggttcccctctgcagattctgaccgcatctcccctctaaggagtatccctgaaccta
gtggggaggggcaggggcagactctaccctcacccatgaagaggagtagggagagggaga
agatgcttgggctttgagctccctctgggaagaggtggtaagcttggatctcagggtcac

 1.02 Intr +   1776   1906  131  1  2   91   94   194 0.985  20.71
gaacctagtggggaggggcaggggcagactctaccctcacccatgaagaggagtagggag
agggagaagatgcttgggctttgagctccctctgggaagaggtggtaagcttggatctca
gggtcacaagggccctgcgtgctccctcattttgcttctcttttgactggcctcccccag
GGAAGGTATTCAGCCAAACGACCATCTGCCGCTTTGAGGCTCTGCAGCTTAGCTTCAAGA
ACATGTGTAAGCTGCGGCCCTTGCTGCAGAAGTGGGTGGAGGAAGCTGACAACAATGAAA
ATCTTCAGGAG
gtaagggtgggagggggatacccggggaccttccctttcttggcctaatttccattgctt
ccatcactggctcgtagctctccgtctttggtgcagtggttctcagtgggatggagtgaa
attcctcagttctgctgggataaggtccagagccaacccttccaggatcctgccttttca

 1.03 Intr +   2191   2349  159  0  0   80   76   269 0.999  25.08
agtgggatggagtgaaattcctcagttctgctgggataaggtccagagccaacccttcca
ggatcctgccttttcacaccaccacctggctctgctgacacatctagtcacagacccctg
tgatgctgttactcagcaagtccaaagcttgcccttgtcacccccttcccacctgcacag
ATATGCAAAGCAGAAACCTTCGTGCAGGCCCGAAAGAGAAAGCGAACCAGTATCGAGAAC
CGAGTGAGAGGCAACCTGGAGAATTTGTTCCTGCAGTGCCCGAAACCCACACTGCAGCAG
ATCAGCCACATCGCCCAGCAGCTTGGGCTCGAGAAGGAT
gtgagtgccatgtctctctgcgggctccatctctttcccctgtcaccacctcgctttccc
tagctctggctcctccaactgctctagggctgttggctttggacagaatgtccaagcagt
caggcctgtctcagctcattctctaatgtcctcctctaactgctctagggctgttggctt

 1.04 Term +   2612   2878  267  1  0   88   51   142 0.990   5.99
tctagggctgttggctttggacagaatgtccaagcagtcaggcctgtctcagctcattct
ctaatgtcctcctctaactgctctagggctgttggctttggatagaatgtccaagcagag
tcaggcccgtctctcagctcattgtctaatgtcattctcctttctgtcattcactggcag
GTGGTCCGAGTGTGGTTCTGTAACCGGCGCCAGAAGGGCAAGCGATCAAGCAGCGACTAT
GCACAACGAGAGGATTTTGAGGCTGCTGGGTCTCCTTTCTCAGGGGGACCAGTGTCCTTT
CCTCTGGCCCCAGGGCCCCATTTTGGTACCCCAGGCTATGGGAGCCCTCACTTCACTGCA
CTGTACTCCTCGGTCCCTTTCCCTGAGGGGGAAGCCTTTCCCCCTGTCTCTGTCACCACT
CTGGGCTCTCCCATGCATTCAAACTGA
ggtgcctgcccttctaggaatgggggacagggggaggggaggagctagggaaagaaaacc
tggagtttgtgccagggtttttgggattaagttcttcattcactaaggaaggaattggga
acacaaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaa

Predicted peptide sequence(s):


>POU5F1_1|GENSCAN_predicted_peptide_1|225_aa
SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFK
NMCKLRPLLQKWVEEADNNENLQEICKAETFVQARKRKRTSIENRVRGNLENLFLQCPKP
TLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLA
PGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN