GENSCAN 1.0	Date run: 16-Jan-104	Time: 14:49:44

Sequence PNLDC1_1 : 22834 bp : 48.17% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1240   1315   76  0  1   96    7   171 0.730  11.05
cacccgcaggcaggtgtgggcgacgccagcagcacacggggaagctgggcacgtggggcg
gaggcagctgcctggtttccatgtgtgcgccctttaagacccggcggcgcgacggaagcg
cgtgggcagcacgtgggcagcacgtgatagcgctgggcgactccgcggagctgcacggcc
ATGGACGTGGGCGCCGACGAGTTCGAGGAGAGCCTCCCTCTGCTGCAGGAGCTCGTCCAG
GAGGCCGACTTCGTGG
gtgaagagcctgggattcgcggctgtgccggacagagccccttgccccgggcgagcttga
ggagggggtggcgggacggttgccaggccacagggcctcagagagggcctcgggaaggac
aggggggcttccttctccagccccggggcggtgggactttgagcagcaagtacactccga

 1.02 Intr +   1704   1761   58  1  1   92   98    64 0.971   5.74
cgtgcgcccaggtgcctggctgctccttgccttggttcctccattttcccttcctgacct
cacttggcttcttgagcgcagaggtgagcgcgggtgccttggccgcctgcagatctacag
tgtgaggagtgctggcgatgttctgcacccgaggactgctattttttgccttcctggcag
GTCTGGACATAGAGTTCACGGGCCTTCGTTCTAACCTGTCTGGGCCCCAGCAGATCAG
gtaaaactaaagctgtgtcccctctgtataagagcctggccagaccagcactgtttctgg
ccagcagcctgttggcatttggggggcaggacgttttgtgtggcttgctcctacgtgttg
gaggaccttgcttttttctgtccactaaatgatggtagtgctccctagttgttgtaacaa

 1.03 Intr +   4897   5020  124  1  1   93   86    54 0.973   6.29
ctctctgcctttttcatttagcacccccagtgccaatcatagctcctgaaacacagcaga
cactcgggcacactcagattcttcttgcctaaaagaaagagcccaccctgaagccagccc
tgggagccagagttttttaaatggttgtggctttttctctgtatgtttgttttattatag
GTATATAGCCCATTCTTGTAACTTCTATCTCTTCCCTACAACGTTTGGGATTTTGGACTC
AGAATTCTCCTTCCAGGCTTCCAGTGTTCAGTTTTTGAATCAGTATGGCTTCAACTATAA
CAAG
gtatggcattggaggaggggaacgggaatgtcttttgtttgtttctgagatggagtctcg
ctctgttgcccaggctggagtgcagtggtgcaatcttcgcctcccgggttcaagtgattt
tcctgcttcagcctcccaagtagctgggattacaggcacccgccaccatgcccagctaat

 1.04 Intr +   5481   5569   89  2  2   69   80    28 0.943  -1.13
gctggggttataggcatgagccaccgcacccggcctgggaatgtcttacaagtgatctag
acgaactggcttatacagcccgtctcctttcccctttctacctgtcctcgtgaaatcagg
cacagaggatccctctgacttgtctccttgttctgtttgttgttctgtttctgtcttaag
TTTCTCAAAAACGGAATCCCATATATGAATGAAGAACAGGAGAAGAAAATTAGACACGAT
ATCCTGACTGGGAACTGGAGAGTTCGCAG
gtatggcctgtttctccaggtgcctttttgtttccttgttgctgttgtctgcatttcccg
tgggcgggcgtgccgtttccaggagtgtggtgacctccatccatgcttggcggggatggc
ttcagctgcctgtgcagctggcgctgctctccctgtgccccaactgagaatggctttcac

 1.05 Intr +   6915   7015  101  0  2   80   70   137 0.996  10.85
attgtttggcttcctattgcataagagcctcagagaagaaatcgtcttcttttggtacat
tttctttgtatattgcaacatgaaaaccagagggttcagaaactgctctcatgttaacat
agtcttgcggttctgaagtgtttttctctgacatgttcactttcatgcgcccattttcag
CTCTCCGGATAAAGACCAAATCAAGGTGGTGATTGACGAAGTGACGCGGTGGCTGGAGCT
GGCCAAGGAAGGCGACTGGATGACTCTTCCTGGGATCACTG
gtaggcagggcctgttcctcccaacgcaggagcattgggacaggtcactgtcacctgcca
ggagttgggggaaacacaccctttcttgggatcctggtcccaagtgcctcatgactgagt
ctgatgcaagcatttgtttggcggttacggagtctttgtggttaaagttctgacctgcat

 1.06 Intr +   9672   9748   77  1  2   92   84   103 0.988   9.53
tgccccagatcccatcatgacaggccaggccctgccacatggctcatgggcttgggcacc
cttcaagctccctttccacttgacctttccatctcagcttctgctcctccagggcttctc
ttgtggggaacatgccacacggttccaggtgctgtgtgcccctgtgtttccctgctgcag
GCTTCCAGGCCTTTGAGGTCCAACTGGTGCTGAGGCAGGCCCTCCCCAACATCTGGACGG
TGCTGAAAGATGAGGGG
gtgagttctcactgcgaacggggcatcagtggctccattgtttctctctcataattggcc
aaatctggcctctgaaaagcttttatcttgcacgctgctagtttttccccctttcctttt
gtttagagatgcagagccatttctttaggcctcattcctagtaacccaggattcagggaa

 1.07 Intr +   9947  10090  144  1  0   93   97    22 0.876   4.08
cggggcatcagtggctccattgtttctctctcataattggccaaatctggcctctgaaaa
gcttttatcttgcacgctgctagtttttccccctttccttttgtttagagatgcagagcc
atttctttaggcctcattcctagtaacccaggattcagggaatttgtccctgcttttcag
GTGGTAGTGAAGAAAGTGAGTAAACAACATCGTTGGTATCTTCAGAACACCTCTTGTGAC
CGAGAGAGCTGTTGGAAGGAAAATATTCTTCTCTCAGCAAGGGGTTTTTCTGTCTTTTTC
CAAATGCTGGTGAAAGCCCAGAAG
gtaggaaaacatgtctcttttcttggcctaaaggcagtctttagtatttctggtcataga
tactaaaggctccttcaacaacaagataaaattctttgagataagtgattccttctcatg
aattttttcatgttttactttcagatagggtctcacctgtcacccaggcaggaaggagtg

 1.08 Intr +  10958  11027   70  1  1   24   91    40 0.978  -3.35
tgttggcatttaagcggttgaactacctttcacagaggcaaaggaaggttaggatggaac
tgtcaagtgatcagaattgcagtgggttctaacactatatcttttgcaagaaactgttag
tctgtagtgtctggattacatttttttattttctctcacctgttgatttactccaagtag
CCCTTAGTGGGACATAATATGATGATGGACCTGCTGCACCTCCATGAGAAGTTCTTCAGA
CCCCTCCCAG
gtaggggcaaacctgtcatttctcttccttcacgctagtttgccatctggcagagggatt
ggtacacaatcatacccctgaggcagctcctaaaatgcccattcctccccagtgtctgca
ggtttctggagagtttgggcagaggcctgtactctgatctgttactgtctccccagagtg

 1.09 Intr +  12633  12718   86  1  2  115   90    75 0.983   9.94
tggcagcttgatctgagtttagaaatccttagtggctaggattaatggtgttttcaattc
ctgttttgtttcagtttgctttattaatcagtgccagtggcaagctaggttcaagaatgt
tccttcccatttttgccaacaaacaaattcactcttgactacctgggtttttcccctcag
AAAGCTACGATCAATTTAAGCAGAATATCCACAGCCTATTTCCTGTTCTCATTGATACCA
AGAGTGTAACAAAGGATATCTGGAAG
gtaatgaatagaactgctttgggttaagaactgctttttccataccagtaacacttagct
ttctcttgtggggtttttttcttgtgtttttttgttttttttgttttgttttgttttgtt
ttgttttgtttgagagggagtcttgctctcaaagccaggctggagtgcaatggcgcgatc

 1.10 Intr +  14533  14588   56  0  2   49   94    26 0.720  -2.92
atactgcgtaccctgacatcctaactaaggaataaggatggttgcaccatttgaagagaa
agaggaggttgtaggagtgagcattttccaggccattttaatgaccatttggtactgcct
gaaacagagaataaacaaaagcgcaaatgttttcctctggtttgttttccatgattgtag
GAGATGAATTTCCCGAGGGTGTCGAATCTTTCGGAAGTCTATGAAGTCCTGAACAG
gtgaggacggcgattcctggagctactgctggagcggccttggtggcctccctgtgctcc
gcaggcctttgggctctctaggcgtgcccaccattcacagtgatgcctgcttgggacttg
gtctcctccagctcctcctgcttcatggcccccttcctccgatgaccctcttgcctccgt

 1.11 Intr +  15132  15217   86  0  2  119   23    65 0.503   2.56
tccccacccctacctgccccttcccggggtgtctccacctctttctgtctccctctcatt
tccttccacatcaacaagtgttctcccaacttaacgacaaagcctcctgaactctctatg
ctcctctttcctcagcccacggcaggcagggccttgtctccttcactctgctctccgcag
GGGCACCCAGAGCCGCCAGTCTGTCCCCAGTCAGCAGGACGAGGCACGAGAGGCGTTTGG
AACAGGGATGGCACCCTGTTCTGGAT
gtgtgtgtgcgattttttaaaacccattccttgtgattcgtgttctctacctgtctccta
cgttttctctcaagggcccctcctcaaccgtgttcctgctcattcctaggctcccatgtg
gcctcatccaccccctgggcttcaactcccagctcctgtgtaccgctgcggtccagacct

 1.12 Intr +  19232  19355  124  0  1   57   42    98 0.804   1.74
ctgcgctcaggtgtgtgtgctccctggacagagggggcactggcagtgggaggaggctgt
gggatgagggatgcccttttggaatcaaaggtgatgtcttaccaaggggggacagcatgg
ggctttctctgaatagtggcctcgcactgattctctgagcctattgctgtttgtcaccag
TGGGACCCTCACCAAACCATCACCAGCAGATGGTGACTGTCTGGAAGCTCTTCTTCTATG
TGGCCACGGAGAATGCTTTTAGACTTGCCAGCTGGGGAAGCACCCAACCAGAGCCCCAAG
ACTT
gtgagggcaggagggagggagagccgtccgagggagtgtccttctgttctgtcaccggat
tcttggctgtggccgaggaagtggatgaacttctgtgcgcccgacagctttggggttttc
tgtccttgcagcatcgaccccgtgcccgagtcatcctttcctcagtaccttgacgtgctg

 1.13 Intr +  19487  19586  100  2  1   88   78    92 0.886   8.31
cttttagacttgccagctggggaagcacccaaccagagccccaagacttgtgagggcagg
agggagggagagccgtccgagggagtgtccttctgttctgtcaccggattcttggctgtg
gccgaggaagtggatgaacttctgtgcgcccgacagctttggggttttctgtccttgcag
CATCGACCCCGTGCCCGAGTCATCCTTTCCTCAGTACCTTGACGTGCTGGCTCCTTACGT
GAACCAAGTGAACCTCATCCGAGCGGGGGTCCCAAAGATC
gtgagtagatctcatttggccccctcgccccattcagagttcagaggctttgctgggaag
cggccagtgctctctgggactcgtgagagggatttcggtggtcggtgagatgagagctgg
gtttttctttcctctcatgtttctccactaaagccaacatggactcatccttccttctct

 1.14 Intr +  19878  20053  176  2  2   83   33   140 0.893   6.74
gagagctgggtttttctttcctctcatgtttctccactaaagccaacatggactcatcct
tccttctcttcccctccctgccccaagcagagcctttcctagtttcttttgagatcttca
gactggataagaagtcaggaagaactgtggaaaatctcttgtgttctgcatgttttctag
AATTTTTCTGGTCCAGATTATCCCAGTATCCGACCTCCCATCCTCATCCTCAGCGTCAAA
AGGTGGCCTGGGGTCAGCGAGCAGCAAGTCTACCATAAGTTTCAGAATCTCTGCAAGTTT
GATGTCAGGCGACTCACAAGAAGCCAGTTCTTACTCCTGACCAATAAGTTTAAGGA
gtaggtgcctctaagtccgcgtcccccacccctcgtgcgttcatccctgtatctctctga
ctccacccgcctgatcacagcaggcggcgccatcctgctgcctggctgaccacagcaaac
ttgttttggcagtgcgcggaacatcctgaaggagtaccgggaccacccgaccctgtgcat

 1.15 Intr +  20186  20284   99  2  0   65  100   220 0.919  20.13
gcgactcacaagaagccagttcttactcctgaccaataagtttaaggagtaggtgcctct
aagtccgcgtcccccacccctcgtgcgttcatccctgtatctctctgactccacccgcct
gatcacagcaggcggcgccatcctgctgcctggctgaccacagcaaacttgttttggcag
TGCGCGGAACATCCTGAAGGAGTACCGGGACCACCCGACCCTGTGCATCTCCCTGTACCG
CTACTGGAGGCACTCCCCAAACGTCAACTGCCTGCTCCA
gtaagtgacaggctgaggccacctgcctgtcctggggtcctggagtgcccggggtcccag
catcccagcatggtctgactcgagcacagctcacttgctggtgtgtgttgccaagggggt
tgtgttgacgagtgtggtgccctgaatgtccttcagtgatgccgcgtgtctgtcgagcac

Predicted peptide sequence(s):


>PNLDC1_1|GENSCAN_predicted_peptide_1|489_aa
MDVGADEFEESLPLLQELVQEADFVGLDIEFTGLRSNLSGPQQIRYIAHSCNFYLFPTTF
GILDSEFSFQASSVQFLNQYGFNYNKFLKNGIPYMNEEQEKKIRHDILTGNWRVRSSPDK
DQIKVVIDEVTRWLELAKEGDWMTLPGITGFQAFEVQLVLRQALPNIWTVLKDEGVVVKK
VSKQHRWYLQNTSCDRESCWKENILLSARGFSVFFQMLVKAQKPLVGHNMMMDLLHLHEK
FFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNRGTQSRQ
SVPSQQDEAREAFGTGMAPCSGLGPSPNHHQQMVTVWKLFFYVATENAFRLASWGSTQPE
PQDFIDPVPESSFPQYLDVLAPYVNQVNLIRAGVPKINFSGPDYPSIRPPILILSVKRWP
GVSEQQVYHKFQNLCKFDVRRLTRSQFLLLTNKFKDARNILKEYRDHPTLCISLYRYWRH
SPNVNCLLX