GENSCAN 1.0	Date run: 16-Jan-104	Time: 14:42:28

Sequence PHF10_1 : 22380 bp : 39.44% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1093   1259  167  1  2  -22   70   318 0.517  17.68
cccagcctttggcgccctcccgcgcgggcggcgcgctggcgacggccatggcggtggcgg
cggcgctggcgggccgcggggcgcgcggcggcaggggccggcccccgggcgggcgggcgg
agggggcggggccggggcggcggggggcccgcgcggcggcggcggcggcggcggcggcag
CGGCGGCGGCGGCCGGGACAAGGCGGAGGCGACGGCGGCGGCGGCGGCGCGGGGCGCTCG
GGCTGATGGCGGCGGCGGCCGGGCCCGGGGCTGCGCTGTCCCCGCGGCCGTGCGACAGCG
ACCCAGCCACCCCCGGAGCGCAGTCCCCGAAGGTGAGGAAGCGGCCG
gtgcgacccgaccctgaccccgtcccgggcctgggtgccggggcgtgggcccagtcccac
cggcggccgcccagcgtctcgggggcgtgggcccaggccgggcgccgcgcctgagaccgg
gggtggtcggcgaggcggggccccgaggtgagcccgcggcctctagcgagcaacaagtgc

 1.02 Intr +   7183   7266   84  2  0   16   82   107 0.663   1.77
acttttgtatcttgctgagttttatttcttgaatttataaatttttttgtagccccttta
ataatatttggaatatgtaatatgaatactttaaaaagtcaaggtttttaagcttttaaa
agttttacaagtgcataaggttttgctgtttttaatagtcttttgatcttttttttggag
ATTTAGAGCGACGAGATTTGTCTCACAAGGAGAAACTCTACCTGAGAGAGCTAAATGTCA
TTACTGAAACTCAGTGCACTCTAG
gtaagaatagctttttaatgtgaatttttcaagctgaacatttatgagataatactagat
aagtatcttatttcctaaaatattttacaaaattaataaaataaattgaactatttaaat
gctacattatttacttcatttttgattattgttaaaatacacaggagaatgaagcttgaa

 1.03 Intr +   9001   9134  134  2  2   49   94   140 0.997  10.14
tcgagtttatattgtgaatattaagtttaattattttcaaatgtactaagatattttgct
ttggctattggaaaaccattacaacgtggagcggtttgaagaattaaattttgaagagtg
cttttgttcacttatccttaaaagagcttctttatttttttattttttggtctaaaatag
GCTTAACAGCATTGCGCAGTGATGAAGTGATTGATTTAATGATAAAAGAATATCCAGCCA
AACATGCTGAGTATTCTGTTATTCTACAAGAAAAAGAACGTCAACGAATTACAGACCATT
ATAAAGAGTATTCC
gtaagtaattgaggtgactggcattttttatttgggttggggaaaatgacattttagaaa
gttatatgtgacttccaactgtattttttttttccagcaaatgcaacaacagaatactca
gaaagttgaagccagtaaagtgcctgagtatattaagaaagctgccaaaaaagcagcaga

 1.04 Intr +   9232   9381  150  0  0   94   16   207 0.999  13.54
atccagccaaacatgctgagtattctgttattctacaagaaaaagaacgtcaacgaatta
cagaccattataaagagtattccgtaagtaattgaggtgactggcattttttatttgggt
tggggaaaatgacattttagaaagttatatgtgacttccaactgtattttttttttccag
CAAATGCAACAACAGAATACTCAGAAAGTTGAAGCCAGTAAAGTGCCTGAGTATATTAAG
AAAGCTGCCAAAAAAGCAGCAGAATTTAATAGCAACTTAAACCGGGAACGCATGGAAGAA
AGAAGAGCTTATTTTGACTTGCAGACACAT
gtaggataacttaaatttagtaccccctgaacttagtttattacttgttattgcagagtg
cccatcaccccctttatcgttattttttgtaccacctatgtgtgtgtgttttttttgttt
gtttgtttgttttgttttgttttttgtggcagagtctgtgtagcccaggatggagtgcag

 1.05 Intr +  10247  10395  149  1  2   62   87   103 0.818   5.71
caataatatatagaactgaaagcaccaactgtcctcttaggttatagctcctgatatctc
ctaaaattttagcttttcgagggggaagtgggcgtgcagtggtgagcacgtggggactct
tcctaaagccttgattcttagcatggaatcagttttgtgtttctctttatgttaacgtag
GTTATCCAGGTACCTCAAGGGAAGTACAAAGTTTTGCCAACAGAGCGAACAAAGGTCAGT
TCTTACCCAGTGGCTCTCATCCCCGGACAGTTCCAGGAATATTATAAGAGGTATTTAGTA
GTTTTAGTTACAGTTGGTATCGGCTATTG
gtaaggggtttcagagccttttgtacttgcctcctaacaattttggggtctatagatatc
accgtaagatatcgtataggatttgtgttgctattcttctctggttctgtggtaaacaat
accctgtagtcagaatttgaatatatgctggtgaagtctagatgcctctgtctctgccca

 1.06 Intr +  12550  12703  154  1  1   44   89   281 0.980  22.95
gaaaagatgttcaggctttttattaaccctacttgatgacaaaaatgaaaaattagtact
ctagttttcaaaagtcttcggggttactcaagaagtttaaggctatcttcataggtcaaa
gatgagtctgtttatatttaataataaagggaaaccaaaaataaactctctgaacttcag
GTACTCACCAGATGAGCTGCGGTATCTGCCATTAAACACAGCCCTGTATGAGCCCCCTCT
GGATCCTGAGCTCCCTGCTCTAGACAGTGATGGTGATTCAGATGATGGCGAAGATGGTCG
AGGTGATGAGAAACGGAAAAATAAAGGCACTTCG
gtgagaacatttctctctagtaggaagcatttcctttctctttgaatttttgttacattg
aatttctgtcatcaccctctccttgaaaaaggatggttgcatgtaatttccagaaagtat
tcatcaataaaagttacttatagtatgttttgataaaaacaagcagtgaatggcctttgg

 1.07 Term +  14698  14874  177  0  0   59   41   136 0.754   2.70
tttaacataacttactttagtctccactggaaaaagctttcttacatttagaatgatctt
tttatttttaaaatgataaagctttaaaactttctttgaatattttccatagttttcaaa
atccagactcaaatttgtcttaattccaaagaatctttgtttttgccttttaaactccag
GACAGCTCCTCTGGCAATGTATCTGAAGGGGAAAGCCCTCCTGACAGCCAGGAGGACTCT
TTCCAGGGAAGACAGAAATCAAAAGACAAAGCTGCCACTCCAAGAAAAGATGGTCCCAAA
CGTTCTGTACTGTCCAAGTCAGTTCCTGGGTACAAGGTAGAAGAAAAAAGCCCCTGA
ctcagcttctttactgaccagcctctccctgaaatattttaacttgactttcacgattgt
ggagcttctgcctgctgtacctcactagctgttcttctatggtgtgccctttgtccgctg
ctttcttttttgctttatttccttggtggcttttctgtcacttttggctatggtttacct

 2.02 PlyA -  15734  15729    6                               1.05
 2.01 Term -  22289  22054  236  0  2    7   47   308 0.724  14.10

Predicted peptide sequence(s):


>PHF10_1|GENSCAN_predicted_peptide_1|338_aa
XGGGGRDKAEATAAAAARGARADGGGGRARGCAVPAAVRQRPSHPRSAVPEGEEAADLER
RDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQR
ITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHV
IQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYLVVLVTVGIGYWYSPDELRYLPL
NTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDS
FQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKVEEKSP

>PHF10_1|GENSCAN_predicted_peptide_2|78_aa
XGIGVYGHPSHLESEFEMKVYYDGTVEQHPFGEAAYPADGADAGQKHAGAPEDASQEEES
VLWTILISILKLVLEILF