GENSCAN 1.0	Date run: 16-Jan-104	Time: 14:28:40

Sequence PGM3_1 : 26705 bp : 39.93% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    300    594  295  2  1   66   49   249 0.758  14.46
cagacacttgcactcttctttatttcctgactccaaaatctagtatgcacaacatcctct
aaaacactccgtaaaaacccatattctgcgtacccgggctccgggttcccgcctcccgca
ccccgcactagataggggaatctgcactttcaacaggtgtttggaactgtcccgctgcag
GTGGCAGGCAGACACCTGCAGACGCTCTGCAAGCCTGAATTCTGGGAAAGGCTGGGGCCC
GGCTTCCAATCCCACCCGGGGCTCGGGCTTGGGCGGAGCCAGACGCTGCGGCGAGAGAGG
CCGCAGTGCCAGCAGGATGGGCTCCGAGTTCCCCAGCGCCAGTCGCCACCCCTCGGTCCT
GGACTCGCGGACCGCCCCCCCCCAACACCGCGGTGGCCTTTTCGCTTGGGCCGCATTCCA
GGGCTCCGGACGTTTACGATTCACTGGCCTCTGCCCCGAGGGACCCAGGATAAGG
gtagggggtgtctcagaggtcattaaataaaagatgtttacagtgagctgggggaagggg
gtacccggggagacggcagccggagaaggcttcccagattcaaaggtttgggagatgacc
tcgacgtcggagagggggatgcgggccgccggcggcgctcactgtgggcgaggtcgccct

 1.02 Term +    820   1361  542  2  2   85   47   259 0.700  14.93
agctgggggaagggggtacccggggagacggcagccggagaaggcttcccagattcaaag
gtttgggagatgacctcgacgtcggagagggggatgcgggccgccggcggcgctcactgt
gggcgaggtcgccctgtccgaggcccagcgacggggctgattccccacccccgcccctag
CCAAGACCACTAGGAACCCCGGCTTCCCAGGAACGCAGGGCCTGCCGCCCCCAGAGGCCC
GGATTTGGAGGCGGAGGCTGTGCCTCCGCGGCCGCAGTGCTCTGAGGGCCCGCGACCCTC
GGCCCCAACCCCCGGGCCACCGCGGGGGCCTCACCCTTTCTGGTCACTCAATGGTAACAG
CCCCAGACCCCGCTCGGAACCGCAGCCGCAGTTCCTCAGGCGCCAGCTGCGCGCGACCTG
CGGCGAGGCGGGGGCGGGGCTGGCGGATAGTCCTCTGCCGTGATTGGCCAGGGGGCGTGG
CGACGAGCCGGAAGCCACGCAGGGCCACGTCTGCGGTTCTGAGGACTGGGTTTGGGTGCA
GACGTTGTTGCTTGGGCGCTTCTCCGCTGCGTGTAGGTGAAGGGGGCTTCCTGACCGAGG
TAAGCCGGGCCCCGAGGCTCGGAGTTGAGAAGGGAGACTACCGGTCGGCAAGGGCTCGGT
GGGAGCGGGACAGGTCAGATTCTCGGCCCGACGGAGGGGCTAGTGGTCTGGCGGGCGACT
GA
ccgagcggcggagcgcgcgggacacacctacaggcccctgcgccccgcgggcgggctggt
cgggacgggccgcgggtctcctgccggggctctggtacgtggacctaggcggggacctca
gggtggagtgccgggaatcacccttgtgcggtgattcgagggtaggcgggagagaggcac

 2.01 Init +   3405   3608  204  2  0   90   80   136 0.713  11.90
ttgtaggtaattctaacccacaggacttactctcctgcccattgctctgtcaaacatagg
gttctttgaggaggttcaggatgagacagacctattcgtttggggtggcagtttttgaag
caaatggttcttaagaaattacttgttatgcccgaaacaatatttcttaattttgtagac
ATGGATTTAGGTGCTATTACAAAATACTCAGCATTACACGCCAAGCCCAATGGACTGATC
CTTCAATACGGGACTGCTGGATTTCGAACGAAGGCAGAACATCTTGATCATGTCATGTTT
CGCATGGGATTATTAGCTGTCCTGAGGTCAAAACAGACAAAATCCACTATAGGAGTCATG
GTAACAGCGTCCCACAATCCTGAG
gtaatgggtttagtgccctgataaagcagaccattatttacaagaccaagccttagtgtc
tgagcaaattgacctaaagtacaaattctaattctaggaatgtgccttctcatttatatg
tgctttggatgtgaaacaactttttttttttaagagcatgatcattaagctcatgattcc

 2.02 Intr +   5619   5803  185  2  2   81   64   180 0.994  12.56
atgaggtaatatatatacataaaatacctaatccagggtccagtattaatatttggtgtt
tattgttgaagctgctcagccatcactgtctttggttgaagggaaacagcttttgagttc
tgttctcaactcagcctcatgagtatgcacagattgcttattgtttgtttttcttttaag
GAAGACAATGGTGTAAAATTGGTTGATCCTTTGGGTGAAATGTTGGCACCATCCTGGGAG
GAACATGCCACCTGTTTAGCAAATGCTGAGGAACAAGATATGCAGAGAGTGCTTATTGAC
ATCAGCGAGAAAGAAGCTGTGAATCTGCAACAAGATGCCTTTGTAGTTATTGGTAGAGAT
ACCAG
gtgatgataagagttactggtaaaaaaaaaaacctttgggaacgtgatataaacgattgt
atcagttttaatccaagacaaatggaaagaagtaaagtggaactaccctgagttgcatgt
ctacctgcctggcctttctagtaggatgtagtagctaagtcactactgcagcttggggtt

 2.03 Intr +   7342   7409   68  1  2  111   80    49 0.947   4.03
aggctactggaaaatgcttataatttaccagttatcttgagagttcatagctttcagttc
agataccaggaacttactattttgaaatttgtagcatgtaatttttgcatttgcttgcag
aaccagcaaccctgccagtttcaggatgggatatattattttcttccttttctttcctag
GCCCAGCAGTGAGAAACTTTCACAATCTGTAATAGATGGTGTGACTGTTCTAGGAGGTCA
ATTCCATG
gtatgtagttatcctgagttggaaattaaactaatatttaaaaaactttaatttacaaaa
gtaatgtatatttatttagaaaagtttgaaaatacagatgaacaaaaaatgtttaaaaaa
tgaactcctagatacaaaatactaactttaaaaatcatcttccaggtcgtttctgggcag

 2.04 Intr +  11439  11572  134  1  2   59   67   178 0.967  12.24
tggttttttggcttcttatagtcatttatatttctttttaagatcatttttatgttttct
aagatgtctgagatgacacaaaaggatttgtcaccctgaaattcctacacatgaatgcat
ttaaacttttttctctttgttaagaaatgcggtgaattgctttttgtatttctatgacag
ATTATGGCTTGTTAACAACACCCCAGCTGCACTACATGGTGTATTGTCGAAACACGGGTG
GCCGATATGGAAAGGCAACTATAGAAGGTTACTACCAGAAACTCTCTAAGGCTTTTGTGG
AACTCACCAAACAG
gtgaaaagtttattgaacatggttaaagttaaacaaatgaataaagtaacatggtctact
gaacaaattatcttgtttgtcatgcctcctctttccttttccaaagatgctgcatatctc
cttttttgtttttctctagggctacacaaggttctggtctatgtatcctgctaacttaca

 2.05 Intr +  12486  12681  196  2  1  107   75   124 0.981  11.07
ttactttagtgttttataattttaaaaattgaaaaatgaacacaattataattgataaaa
tttaaaaattaaaatgagttaactaaatatttacatatgcacatatgtatatatgcttta
tatttcacatttatttttataacttgaaatttttcttccatgtgtctttttcctttgtag
GCTTCTTGCAGTGGAGATGAATACAGATCACTTAAGGTTGACTGTGCAAATGGCATAGGG
GCCCTGAAGCTAAGGGAAATGGAACACTACTTCTCACAGGGCCTGTCAGTTCAGCTGTTT
AATGATGGGTCCAAGGGCAAACTCAATCATTTATGTGGAGCTGACTTTGTGAAAAGTCAT
CAGAAACCTCCACAGG
gtatgtcgtactagcactgcaaaaatttgtttttaatgctctttgaagccaatctcactt
ataaactaaggtggtaaagtgagttaagaatcttgcagctattcctggctctgccacatt
tagacattgagaagtcttcccactctcagagccattgaaacatggtctgctctctctgcc

 2.06 Intr +  14450  14607  158  0  2   42   64   116 0.907   3.41
ctttgcagtgaaagaatttgacctgtaaaaaccactaataaactatgtactatttaaaga
ttatacactatttaagattaagacattgatttttaggtggataattttaagagaaaattc
taaaactctttataataaattcttagactgaaatgcatgttaaattatcctgtgtgctag
GAATGGAAATTAAGTCCAATGAAAGATGCTGTTCTTTTGATGGAGATGCAGACAGAATTG
TTTATTACTACCATGATGCAGATGGCCACTTTCATCTCATAGATGGAGACAAGATAGCAA
CGTTAATTAGCAGTTTCCTTAAAGAGCTCCTGGTGGAG
gtatggtggggggattggctaccctctaaaacaagacttagtagtgaaatagttccatat
tttacaatcatttgtcagaagggcacaatttatgacaaattctttacattagtgggcaga
aaattaaaaaaagagcagtggtaatacccagtcatttgaacatttgaggcattggctttg

 2.07 Intr +  15661  15744   84  0  0   59   67    61 0.491   0.20
tcaaatgtattttaggcttttttcctggcatacatgtaaattttcagtcagacatttttg
gcataaactaaggcacaactgaactggctgataattttggtagcctttagaactctcatt
atatttgtttttgtagaccatacttttgatggcaagttaagtatcattgtttttgtctag
ATTGGAGAAAGTTTGAATATTGGTGTTGTACAAACTGCATATGCAAATGGAAGTTCAACA
CGGTATCTTGAAGAAGTTATGAAG
gtattgaaccatttttgttttctggtagtttcttaattaagatcatgtttctgtgagaaa
gatactgccctcataaaagtgattatgttgtagtgcatgaagctgagctgctgttcatgt
aaaggtaaagagaaataaataagaaaaaatttagttgtccttgatgaataaaggaaaact

 2.08 Intr +  16175  16242   68  1  2   46  108    54 0.707  -0.02
tgtaagtctttctaaaggcctaataagccagttttatagctcaggaatacttttctttaa
gggcctagagtcaccaatttcaaatataaacatcaaggaagatagctcacctatctccca
gtctcaggagagtttaacttaggtgtttgcgtccaatttgtaactatctacctgtcacag
AGGTATGAAAAGTTTTATTACTCCTTTAGAGAAGGGCAGTTAACACAGGTGGCCATCCCT
ATTACCAA
gtaagtttaggataaactatgtgtgtgacaaatggtggtttcaagttttcctatttgagg
actagtgttaaagaaaaaataattcatgacacttgttaaaatggtaaggcagacttgatt
caggactgttgtgataggtacagggactaatgtgatggagttttgcagtggtaggagaaa

 2.09 Intr +  17210  17252   43  2  1   77  103    41 0.769   1.82
caggtgaccacccttggcaccacactacttgctcggagagttaccagggttcatggacaa
aactggaagtctgtttgcctatactttctcattatcgagaagttttccaacttttttgta
cctcattttgtacctcgttctggcatttatactagttttagttacctttccattctctag
AAAGCAGGAATTACAAAGTCAGATTCCTGCAGGATTTGGACAG
gtaaagtgaatgagggcagcagggggctaaaaacaggtcagtatgtgccagctgatgtca
actgtagtcacactcttcaagagaagcaggaaatctgaattttcatgtgatgttcctatt
tgtttaaaaagaaacagtggctgggcaaaacgaaatatatcttgaggctgctagtttatg

 2.10 Intr +  19930  20043  114  0  0   90   71    97 0.883   7.92
ctatcctctgggttttaatgtgatcttacattaatttcatacattttaaggctgccacta
tttttcccctcagtttctccagattgactaggagggaaaagtgggttagctagaataata
gtacttatgactaggttttggatagtgttttgagactgattttatattcttttgctgcag
GCACTGTTTAGTACAGCTGTTGAAATGAAGATAAAACAATCAGCAGAACAACTGGAAGAT
AAGAAAAGAAAAGCTGCTAAGATGCTTGAAAACATTATTGACTTGTTTAACCAG
gtcagaactgatggggcagtggactcttggttacctttacattattcagaagatggacag
aacagagtgtgggtgcatacaaaattaaagtggagacgtcctggcctggtggcttccttc
taatagtggtatattcagttgagatttataatgaaatggaatgacagaacattttttaat

 2.11 Intr +  22358  22480  123  1  0   91   64   144 0.998  12.16
attttgacctgtcacaggaggccaggtgtggaatttttcacttgtgattattttggcact
cagcatgtttcagattcaggttgttcaacctgtactgtgattggttttctaagaaaaaac
atccatttccaagatttgcttgtgttaagtggtttcttccatttgtttccccatttgcag
GCAGCTGGTGATGCTATTTCTGACATGCTGGTGATTGAAGCAATCTTGGCTCTGAAGGGC
TTGACTGTACAACAGTGGGATGCTCTCTATACAGATCTTCCAAACAGACAACTTAAAGTT
CAG
gtgtgagagaaactttaaagtaacttttttgaatattagctaagtaaaacctattatccc
aattctcattatatctcactgacatatgtttcctatttcattctgtacatacacatatga
tacatagaaaataaggccttatgggccaagcgcagtagctcgtggctcatgcctttaatc

 2.12 Term +  23939  24157  219  1  0   21   45   262 0.178  11.26
agactgaagaaaaagagaaaagttgcacaaatgttgaaattaattaccctgaccttggag
aaagaagttttaatgtaattttatatttagtctggcacttttcgtagaatgtatgtttaa
caggttaagcttctgaaaggaagtgtaatagagtaacaaatatgaaatgcttgcacttag
GTTGCAGACAGGAGAGTTATTAGCACTACCGATGCTGAAAGACAAGCAGTTACACCCCCA
GGATTACAGGAGGCAATCAATGACCTGGTGAAGAAGTACAAGCTTTCTCGAGCTTTTGTC
CGGCCCTCTGGTACAGAAGATGTCGTCCGAGTATATGCAGAAGCAGACTCACAAGTAAGC
TGGGATAGTTCTATTGAAAAAGAGCCTAATATTAGGTGA
tgggcaggcaaactattttaatggtttttagaatctcactatgatgattaaggctttatt
ttgttgagccttttaggttcacattaagactacaaaattattttcaccagcagtaattat
acaatttaacaaaattagacccacttagtttatttccccaaatatttttgacttattcta

 3.02 PlyA -  24605  24600    6                               1.05
 3.01 Term -  26555  26250  306  2  0  106   53   201 0.992  12.53

Predicted peptide sequence(s):


>PGM3_1|GENSCAN_predicted_peptide_1|278_aa
VAGRHLQTLCKPEFWERLGPGFQSHPGLGLGRSQTLRRERPQCQQDGLRVPQRQSPPLGP
GLADRPPPTPRWPFRLGRIPGLRTFTIHWPLPRGTQDKAKTTRNPGFPGTQGLPPPEARI
WRRRLCLRGRSALRARDPRPQPPGHRGGLTLSGHSMVTAPDPARNRSRSSSGASCARPAA
RRGRGWRIVLCRDWPGGVATSRKPRRATSAVLRTGFGCRRCCLGASPLRVGEGGFLTEVS
RAPRLGVEKGDYRSARARWERDRSDSRPDGGASGLAGD

>PGM3_1|GENSCAN_predicted_peptide_2|531_aa
MDLGAITKYSALHAKPNGLILQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVM
VTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQD
AFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMVYCRNTGGRYGKATI
EGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDG
SKGKLNHLCGADFVKSHQKPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDK
IATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKRYEKFYYSFREGQLTQV
AIPITKKQELQSQIPAGFGQALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAA
GDAISDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPG
LQEAINDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQVSWDSSIEKEPNIR

>PGM3_1|GENSCAN_predicted_peptide_3|101_aa
KNPEEDNSGRTLGWEPGHLLLTICTVRSMEQLLPFFNVLSQVFNSKVTSRCGGHSGSPIL
YSNAFPNKDMKLENHKPCSSKARQKIEEMVEKDFLEGMIKT