GENSCAN 1.0	Date run: 16-Jan-104	Time: 17:06:42

Sequence PEX7_1 : 93736 bp : 38.39% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1282   1411  130  0  1   72   76   113 0.670   6.98
aaaaatggtctccgtcggagtcaacgccctttcctgtgcggaccaatcagaatctcaaac
acagggcacggggcccacacttccgtccggtctgcctggtctctctaaccgcgccagtgt
gcctccgactcggaacggcttccgcggccggggcagcgagggccgggggcggcgggcggg
ATGAGTGCGGTGTGCGGTGGAGCGGCGCGGATGCTGCGGACGCCGGGACGCCACGGCTAC
GCCGCCGAGTTCTCCCCGTACCTGCCGGGCCGCCTGGCCTGCGCCACCGCGCAGCACTAC
GGCATCGCGG
gtgaggcggcgccgcgcagctggggccggggggcggaggcggaggcgggggccagccggg
ctccagttcctcgcgctcgagggaaagcccctctgagcgtagacggttccgcgggtccac
gccagggggcagaagaggcgctggtcggcgcttctcctttctttgccgagtgcgaggagt

 1.02 Intr +   1725   1924  200  1  2   50   28   167 0.855   5.05
agaggcgctggtcggcgcttctcctttctttgccgagtgcgaggagttggtctgaagcag
gagtcgatcttccagttgtgtgcaagtgcatatacgtgtagcctagtagcccgtgtcctt
gttccttgagaccgcgctgcctccgccacgtgtcacacgcccaggcacacgtccccgtag
GGAGAGCCGGGGGAGCCTGCGCGGTCCCTTGGATCGGTCCGCTCGGCACAGCAGTACGGG
GAAGACGGTCTGAGCCAGAACCGACCCAGGGCTCGCGAGTTGGCCCACAATTCCCAGTCT
GCATTCGAGCACTGAGCTGCGACCTGCGGGCTGGCCTTCCTAAGGACGATGCTCCTGAAT
GGACGCCTGGAGTCCCACGG
gtgacaccatgaaatatatcaagttcagttcttacctgtagttgtctaacgaggaatgca
cacattcgcaagtaggtgttacagactccagttaattgtctcccgtcgcgcgcattggct
cagcctgtggttaaagctgctcaggaggctgaggcgggaggatcgcttgagcccgggatg

 1.03 Intr +   4930   5085  156  0  0   85   75   158 0.875  13.49
tctgttgccatatttgtcaagtacctactctacttaactcccgtagttgtgcagattaca
tgagatatacgtgttaaaatgtgtgataaattgaaagaaaaaaaaccataattgttattt
tttttgttgtgtagctgcctatgtaagtgttgtatttttttgttgtttgttttttcctag
TGTAGCTTTGACTGGAATGATGGTTTGTTTGATGTGACTTGGAGTGAGAACAACGAACAT
GTCCTCATCACCTGTAGTGGCGATGGCTCGCTGCAGCTCTGGGACACTGCCAAAGCTGCA
GGGCCACTGCAAGTCTATAAAGAACACGCTCAGGAG
gtaggagggaaatctttctgggctgattatttttctttcttcgactttggttgaaatcca
tttggggatggacacatggagaaatatcttcaggggacaagtttaaacgttagcatttct
tatacatactagatgtcacttattatttgattattcaaacataaagtacctcttggccta

 1.04 Term +  10817  10849   33  1  0  114   49    19 0.039  -2.79
gtggggccttcaaccccacattttccttctgtactgccctagcaaaggttctccatgagg
gctcctcccttgcagcagacttctgcctggacattcaggtgtttccatacatcctctgaa
atttaggtggaggttaaactcttgtcttctaaactcttcttgtcttctgtgtacccacag
ACCCAACACCACATGGAAGCTGCCAAGGTTTAG
ggcttgcaccctcagaagcaatggcttgagctgtaccttggctccttttagccatggctg
gagctagagcagctggatgcagggcaccatgtcttgaggctgcacagagcagcagggcca
ctcaggcccacaaaaccatttttccctcctaggccgctgggcctgtgatgggaggggctt

 2.03 PlyA -  12257  12252    6                               1.05
 2.02 Term -  26990  25774 1217  0  2   59   47   350 0.782  18.80
 2.01 Init -  27226  27148   79  1  1   42   40   108 0.732   2.67
 2.00 Prom -  27799  27760   40                              -9.75

 3.02 PlyA -  27870  27865    6                               1.05
 3.01 Sngl -  28584  27928  657  0  0   49   41   268 0.382  14.12
 3.00 Prom -  28677  28638   40                              -6.15

 4.01 Init +  31005  31558  554  2  2   79   39   265 0.551  15.16
tttctggaagcactggaagcattccctttgaaaactggcacaagacagggatgccctctc
tcaccgctcctattcaacatagtgttggaagttctggccagggcaatcaggcaggagaag
gaaataaagcgtattcaattaggaaaagaggaagtcaaattgtccctgtttgcagacgac
ATGATTGTTTATCTAGAAAACCCCATCGTCTCAGCCCAAAATCTCCTTAAGCTGATAAGC
AACTTCAGCAAAGTCTCAGGATACAAAATCAATGTACAAAAATCACAAGCATTCTTATAC
ACCAACAACAGACAAACAGAGAGCCAAATCATGAGTGAACTCCCATTCACAATTGCTTCA
AAGAGAATAAAATACCTAGGAATCCAACTTACAAGGGATGTGAAGGACCTCTTCAAGGAG
AACTACAAACCACTGCTCAAGGAAATAAAAGAGGACACAAACAAATGGAAGAACATTCCA
TGCTCATGGGTAGGAAGAATCAATATCGTGAAAATGGCCATACTGCCCAAGGTAATTTAC
AGATTCAATGCCATCCCCATCAAGCTACCAATGACTTTCTTCACAGAATTGGAAAAAACT
ACTTTAAAGTTCATATGGAACCAAAAAAGAGCCCGCATCGCCAAGTCAATCCTAAGCCAA
AAGAACAAAGCTGGAGGCATCACACTACCTGACTTCAAACTATACTACAAGGCTACAGTA
ACCAAAACAGCATG
gtactggtaccaaaacagagatatagatcaatggaacagaacagagccctcagaaataat
gccacatatctacaactatctgatctttgacaaacctgagaaaaacaagcaatggggaaa
ggattccctatttaataaatggtgctgggaaaactggctagccatatgtagaaaactgat

 4.02 Intr +  42497  42684  188  2  2   33   92    83 0.370   1.61
agctggaaaccagcctggacaacatggcaaaaccccgtctctgccaaaaatagaaaaatt
agcaggggcatggtggtgtgcgcttgtagtcgcagctacttgggaggctgagatgggagg
attgcttgagtctgggaggtggaggttgcagtgagctgagatcgcatcactgcactccag
CCTGGAAATTAAAAGAATTAAAATAATTCCTCCAGAATTAGCCAACATTGATTGTATGGC
ATTTGTCGTCCAGCAACACAAGGAGGCAGCAGCGCAGTGTAGTTGTAAAGCTGTAAAGTG
TGCATGCTGGGGACCCAGACTCCTTGGGTTCTGGTTCCAGGTCCTGGTTCTGTTGCTTAC
TATCCTGG
gtgagttatttcatctttatatgctgcatttgtatagtactatattcctcatttgtatag
tactatacaattacttttatatctccaaattcctactttatgtagttgtgatgtttttag
aaaaaatatgtataaaatgcttagaacagtatgtggcacattggaagcactcaaatatta

 4.03 Intr +  45243  45349  107  1  2   82   65    56 0.429   1.71
tgtattccttcatttgaatagttcctatacattattatggtttaaaaaataagtctgaag
gtggcaatatcctaacactgaaagcagtgtatttttacttgacttattattgtgaacaca
ttatgtcactgcacattcaagtggtgtgatgggaaatgatcaagtcttcctttttactag
GTGATCAGACTCTGAGAATATGGGATGTGAAGGCAGCAGGAGTAAGAATCGTGATTCCTG
CACATCAGGCAGAAATCTTGAGTTGTGACTGGTGTAAATACAATGAG
gtatagtgtatggctctatcctatgctgctgtccttcctaatgttaaaatgttctgaatt
ttatttgtctttgtttatgtggactttggtggtgttcctggaccattaagttaaattctg
tccctttcctttctaattaatgattgtgactgacctgcattagcattaattggatttaag

 4.04 Intr +  48506  48619  114  1  0   64  106    52 0.361   4.32
ttttttgctattaatgtctatgttgattcctgtctatacttgttatacaacttctcaaaa
atgactccttggttcatattaaatagttatcagaaagcagatgttgtttctagtaggaaa
gcctgcatactgtttaattgcaaagatgtcacagtttatgtttctctgaattgtttttag
AATTTGCTGGTGACCGGGGCGGTTGACTGTAGTTTGAGAGGCTGGGACTTAAGGAATGTA
CGACAACCAGTGTTTGAACTTCTTGGTCATACCTATGCTATTAGGAGGGTGAAA
gtaagttttcatcttttcttttatatgtagaataaaattatataaatataatcaatgaag
tgtatattaaaaagtgttctgggtttagggattggagttactaattcttttttatatgtg
tttttgttacccaattaattagtagtgaaagctaaaattaggcaaaaatatttgaataat

 4.05 Term +  52831  52884   54  0  0   77   44    18 0.071  -7.12
agcttttgcgtcaatattcaaaggtgatattagttgcagttttctttcttttctcgtttt
gtttaatgtgtctgtgttttacttgcttcataaaaagaattaagaaattttcctttgttt
ccaaagctctggaacaacttgtacagcattgaggctatttggtctttgaatcctttgtag
GATTGCTCTGCAAAACTAGTGGAGCATGGTGCTTTTTGTGGAGTACTTTCTTGA
taacttcatttctttcatggaagtgagtctgtttaaactttgtatctctaacgggatcaa
gtttggaaattgtcccttgcttttaggttttcaaatttattcgtagaggtgtctgtaaag
tgggtggacacagtggctcatgcctgtattcccagcactttgggaggccaaggtgggcag

 5.04 PlyA -  54970  54965    6                               1.05
 5.03 Term -  57153  56396  758  1  2   13   42   295 0.154  10.00
 5.02 Intr -  60470  60402   69  0  0  101   69    61 0.187   3.74
 5.01 Init -  71628  71532   97  0  1   18   75    83 0.073   0.52
 5.00 Prom -  75951  75912   40                              -2.25

 6.03 PlyA -  76746  76741    6                               1.05
 6.02 Term -  79475  78994  482  0  2   15   36   486 0.672  30.07
 6.01 Init -  84707  84635   73  2  1  114   82    26 0.496   5.88

Predicted peptide sequence(s):


>PEX7_1|GENSCAN_predicted_peptide_1|172_aa
MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGRAGGACAVPWIGPLGT
AVRGRRSEPEPTQGSRVGPQFPVCIRALSCDLRAGLPKDDAPEWTPGVPRCSFDWNDGLF
DVTWSENNEHVLITCSGDGSLQLWDTAKAAGPLQVYKEHAQETQHHMEAAKV

>PEX7_1|GENSCAN_predicted_peptide_2|431_aa
MIISTDAEKAFDQIEQPFVLKTLNKLVLEVLARAIRQEKEIKGIQLGKEEVKLSLFADDM
IVYLENPTVSAQNLKLISSFSKVSGYKINVQESQAFLYTNNRQKESQIMSELPFTIATKG
IKYLGIQLTRDVKDLFKENYKPLLNEIKEDTNKWKNILCLLIGRINIVKMAILPKVIYRF
NAIPIKLPMTFFTELEKTILKFLWNQKRAHIAKTILGQKNKAGGIKLPDFKLYYKATVIK
TAWYWYQNRDLDQWNRTEPSEIMPHIYNYLIFDKPEKNKQWGKDSLFNKWCWENWLAICR
KLKLDPFLTPYTKINSRWIKDLHVRPKTIKTLEENLGNTIQDIGMGKDFMSKTPKAMATK
AKIDKWDLIKLKSFCTAKETTIRVNRQPTKWEKISAIYSSDKRLISRIYKKLKNKFTRKN
QTTPSKSGQRI

>PEX7_1|GENSCAN_predicted_peptide_3|218_aa
MGDFNTPLSTLDRSTRQKVNKDIQELNSALHQADLTDIYRTLHPRSTEYTFFSAPHHTYS
KTDHILGSKALLSKCKRTEIITNFLPDHSAIKLELRIKKLTQNHRTTWTLNNPLLNDYWI
HNEMKAEIKMFFETNENKDTTYQNLWDTFKAVCRGKFIALNAHKRKKERSKIDTLTSQLK
ELEKQEQTHSKASRRQQITEIRAELKEIETQKTLQKNQ

>PEX7_1|GENSCAN_predicted_peptide_4|338_aa
MIVYLENPIVSAQNLLKLISNFSKVSGYKINVQKSQAFLYTNNRQTESQIMSELPFTIAS
KRIKYLGIQLTRDVKDLFKENYKPLLKEIKEDTNKWKNIPCSWVGRINIVKMAILPKVIY
RFNAIPIKLPMTFFTELEKTTLKFIWNQKRARIAKSILSQKNKAGGITLPDFKLYYKATV
TKTACLEIKRIKIIPPELANIDCMAFVVQQHKEAAAQCSCKAVKCACWGPRLLGFWFQVL
VLLLTILGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDL
RNVRQPVFELLGHTYAIRRVKDCSAKLVEHGAFCGVLS

>PEX7_1|GENSCAN_predicted_peptide_5|307_aa
MISFAFKGVSGHSEKNGLEGLSGYGKISGPKRGALNIYPPLPVLAQDSAFNSGEKSFRQN
STPFMLKTLNKLGIEGEYLKIIRATYDKPTATIILNGQELEPFPLKTGTRQGCPLSPLLF
NIVLEVLARAIRQKKGIKGFQIGREEVKSSVFADDMIVYLESPIVSAQNLLKLISNFSKV
SGYKINVQKSQAFLCTNNRQTQSQIMSELPFTNATKGIKYLGIQLTRDVKDLFKENYKPL
LKEIREDTNKWKNNPCSWIGRINIVKMTIPPKVIYRFNAIPIKLPLTFLTELEKNYFKFH
MEPKKSP

>PEX7_1|GENSCAN_predicted_peptide_6|184_aa
MENQWDDGKSLETRFEIVAVIHGKDQRQSKRRGRDLAQAEKKAVGKGDVPTKRPPVLQAG
VNTVTTLVEKKKAQLAVTAHDVDPIKLVVFLPALSHKMGVPDCAVKGKARLVHRMTHTTI
TFTQINSEDKRALAKMVEAIRTNYNDRHDEICCHWGGNVLGPKSVAHTAKLEKAKAKEPA
TKLD