GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:31:22

Sequence NEU1_1 : 6103 bp : 53.24% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +    359    480  122  0  2   51   48   277 0.629  18.94
cgctctatgcaacataatattcccgaccccacttcacaggaggaaactgagattacataa
cctgcccgggggtaagggtggtggtgcagcttggattccaaatcccgcaggcagcttgcc
tcccagtccccgatttcctggccccagggtccgctctaaccggtctctgttgcggctcag
TGGAAGACCTGGAGCGGAACAACGGCTCCCTGGACCGGCCCTACTACATGTCCAAGAGCC
TTCTAAAGATTCTGGGCAAGAAGAACGAGGCGCCCCCGGACAACAAGAAGAGGAAGAAGT
GA
cagctccggccctgatccaggactgcaccccacccccaccgtccagccatccaacctcac
ttcgccttacaggtctccattttgtggtaaaaaaaggttttaggccaggcgccgtggctc
acgcctgtaatccaacactttgagaggctgaggcgggcggatcacctgagtcaggagttc

 2.01 Init +   1331   1489  159  1  0   82  105    93 0.993   9.78
ctgcgtgatcacgtgggaggagatgagctacttgaagaccaattagagtccgggaagcgc
ggcggggcctccagaccggggcgggcttaagggtgacatctgcgctttaaagggtccggg
tcagctgactcccgactctgtggagtctagctgccagggtcgcggcagctgcggggagag
ATGACTGGGGAGCGACCCAGCACGGCGCTCCCGGACAGACGCTGGGGGCCGCGGATTCTG
GGCTTCTGGGGAGGCTGTAGGGTTTGGGTGTTTGCCGCGATCTTCCTGCTGCTGTCTCTG
GCAGCCTCCTGGTCCAAGGCTGAGAACGACTTCGGTCTG
gtgagtcaccctttgcatagccccatccccgacccgcgcaggtgatcgacacctagtgtc
ccccggaacgcgggcggctgagccgactttccgcgacaggacccttttctttctcccaga
ccccgtttcctcctaccgctcccagcccctctccctctccgggtccccgtccttctcctc

 2.02 Intr +   1916   2108  193  1  1   99   37   326 0.995  28.19
ctcccctgctccgagcctccagcttcgctccaaactccccttcgtgttcctctttcttgt
tctgggaccccatcccctactcgggatccccattagatcctccctctcccatcggaacgt
gggttcctaaaacccccaagacaagtttgtctttgttgacccttcctcctcccatgacag
GTGCAGCCGCTGGTGACCATGGAGCAACTGCTGTGGGTGAGCGGGAGACAGATCGGCTCA
GTGGACACCTTCCGCATCCCGCTCATCACAGCCACTCCGCGGGGCACTCTTCTCGCCTTT
GCTGAGGCGAGGAAAATGTCCTCATCCGATGAGGGGGCCAAGTTCATCGCCCTGCGGAGG
TCCATGGACCAGG
gtataaagatgtctgggtgaaagagccggtgctaggttggatgggtgggcagcccaatga
gcccaagggccctgaggataggggaacttagagggttggttgcctgagtccctgaggggt
agagggaacccgagaagggcaagtgtctaggacagtgatctggaaattgggatcaccaag

 2.03 Intr +   2657   2919  263  0  2   85   20   148 0.788   5.44
taaatgcaatggagaaaaataaaacaggacaagaggtatagatagtgcaagtgttggatt
gcaccctgggaccatcggaaggcctgaggtccctagcagaaggtgggaaattaacgggaa
gtggtagaaagggtacctgcagagtgctcactctgggtttcttcctccaatttttttcag
GCAGCACATGGTCTCCTACAGCGTTCATTGTCAATGATGGGGATGTCCCCGATGGGCTGA
ACCTTGGGGCAGTAGTGAGCGATGTTGAGACAGGAGTAGTATTTCTTTTCTACTCCCTTT
GTGCTCACAAGGCCGGCTGCCAGGTGGCCTCTACCATGTTGGTATGGAGCAAGGATGATG
GTGTTTCCTGGAGCACACCCCGGAATCTCTCCCTGGATATTGGCACTGAAGTGTTTGCCC
CTGGACCGGGCTCTGGTATTCAG
gtctctgtcctaggagataggtggagggggctgccttgtggagagtctgagggatacccc
caaatggactcctttccaaggggaagattctctgaagtcagattttctggcttgggtggg
attccttgaaagacagggcatcctggtaggaacacattatcaggagaagagggaactctg

 2.04 Intr +   3486   3668  183  2  0  105   71   304 0.993  30.90
gagagcttcttaattcaaacagggtgtgtatttatgggatctgactggaaccctcagtga
gcaagggctgaactcaaggggaccatacatgtgattgcatttgggaagtggtgggttctc
tgtccctgcctctgagcccctagagtctccttctgtgacacccagttccctttcccacag
AAACAGCGGGAGCCACGGAAGGGCCGCCTCATCGTGTGTGGCCATGGGACGCTGGAGCGG
GACGGAGTCTTCTGTCTCCTCAGCGATGATCATGGTGCCTCCTGGCGCTACGGAAGTGGG
GTCAGCGGCATCCCCTACGGTCAGCCCAAGCAGGAAAATGATTTCAATCCTGATGAATGC
CAG
gtcaggagtccatgagatgttccctacccatttgaccctccctgccctccagaacatcat
ttcacgcacagacccagggtctgactgctccactcagtgccacacacccttgctcccctc
ggggacagggcattttccctgttccctccctgaggtcctgtcctctcccctcagccctat

 2.05 Intr +   3843   4065  223  2  1  118   75   313 0.852  31.23
tgccaggtcaggagtccatgagatgttccctacccatttgaccctccctgccctccagaa
catcatttcacgcacagacccagggtctgactgctccactcagtgccacacacccttgct
cccctcggggacagggcattttccctgttccctccctgaggtcctgtcctctcccctcag
CCCTATGAGCTCCCAGATGGCTCAGTCGTCATCAATGCCCGAAACCAGAACAACTACCAC
TGCCACTGCCGAATTGTCCTCCGCAGCTATGATGCCTGTGATACACTAAGGCCCCGTGAT
GTGACCTTCGACCCTGAGCTCGTGGACCCTGTGGTAGCTGCAGGAGCTGTAGTCACCAGC
TCCGGCATTGTCTTCTTCTCCAACCCAGCACATCCAGAGTTCC
gtgagtgcctcatgggtggggtcagcagggagagccctgtgtctagacaaggcctgggca
gagaccctctctccctgactctcctgctctccccaggagtgaacctgaccctgcgatgga
gcttcagcaatggtacctcatggcggaaagagacagtccagctatggccaggccccagtg

 2.06 Term +   4162   4388  227  2  2  129   49   279 0.982  25.37
tcgtggaccctgtggtagctgcaggagctgtagtcaccagctccggcattgtcttcttct
ccaacccagcacatccagagttccgtgagtgcctcatgggtggggtcagcagggagagcc
ctgtgtctagacaaggcctgggcagagaccctctctccctgactctcctgctctccccag
GAGTGAACCTGACCCTGCGATGGAGCTTCAGCAATGGTACCTCATGGCGGAAAGAGACAG
TCCAGCTATGGCCAGGCCCCAGTGGCTATTCATCCCTGGCAACCCTGGAGGGCAGCATGG
ATGGAGAGGAGCAGGCCCCCCAGCTCTACGTCCTGTATGAGAAAGGCCGGAACCACTACA
CAGAGAGCATCTCCGTGGCCAAAATCAGTGTCTATGGGACACTCTGA
gctgtgccactgccacaggggtattctgccttcaggactctgccttcaggaacacgggtc
tgtagagggtctgctggagacgcctgaaagacagttccatcttcctttagactccagcct
tggcaaaatcaccttccctttaccagggaaatcacttcctttaggactgaaagctaggcg

Predicted peptide sequence(s):


>NEU1_1|GENSCAN_predicted_peptide_1|40_aa
XEDLERNNGSLDRPYYMSKSLLKILGKKNEAPPDNKKRKK

>NEU1_1|GENSCAN_predicted_peptide_2|415_aa
MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTM
EQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGST
WSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVS
WSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASW
RYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACD
TLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
VQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL