GENSCAN 1.0	Date run: 16-Jan-104	Time: 16:54:52

Sequence NCOA7_1 : 142539 bp : 39.15% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.05 Intr -    471    237  235  2  1  107   50   148 0.545   9.67
 1.04 Intr -  16897  16763  135  0  0   93   64    42 0.011   1.06
 1.03 Intr -  29117  29043   75  1  0  108  108    71 0.329   8.81
 1.02 Intr -  31091  30964  128  2  2   83   38    93 0.301   2.36
 1.01 Init -  43152  43072   81  0  0   80   34    90 0.017   3.82
 1.00 Prom -  50160  50121   40                              -8.05

 2.01 Init +  53487  53590  104  2  2   74  105    97 0.969   9.76
tggtacctgagaatgttaccttttatggccaaagagatcttgcagatgtgattaagggcc
ttgatatagggacattaacttggattgtctgaatgggtcctatatgcaatcctaagtgtc
catataagagggaggtttgactgcagagaaagcagtgtgccatgcagctggctttgaaaa
ATGGAGGAAGGGGCTACCAGTAATATAGCTCTAGAAGCTGGAAAAAGCAAGAAAAGAACC
TCTAATGGGGAGGATGGCCCTGTGGACGCCTTGATTTCAGCCTG
gtgagtctgattttagacttctgacctccagaactgtaagagaataaatgtgtgttaagt
taccaagtgtgtggtaatttggtacagcagccatagggaattaatacatccagtcaattt
aactatgttaaataagctacgtgcataatatcaatgtaaagcaaaagagaataaacaact

 2.02 Term +  57891  58368  478  0  1    4   42   205 0.195   0.83
catttttcaaaaacacatggatcccaaattttaaaattaagaacagagtcatatataact
gtgaatttaatactaattaaagcagtctgtagttcagtacattttaaattatgtgtggct
aatatgtagaaagctgaaactggatcccttccttacaccttatacaaaaattaattcaag
GTGGATTAAAGACTTAAATGTCAGACCTAAAACCATAAAAACCCTAGAAGAAAACCTAGG
CAATGCCATTCAGGACAGAGGCATGGGCAAGGACTTCATGTCTAAAACACCAAAAGCAAT
GGCAACAAAAGCCAAAATTGACAAATGGGATCTAATTAAACTAAAGAGCTTCTGCACAGC
AAAAGAAACTATCATCAGAGTGAACAGGAAACCTACAGAATGGGAGAAAAATTTTGCAAT
CTACCCATCTGACAAAGGGCTAATATCCAGAATCTACAAAGAACTCAAACAAATTTACAA
GAAAAAAACAACCCCATCAAAAAGTGGGCAAAGGAATGAACAGACACTTCTCAAAAGAAG
ACATTTATGCAGCCAACAGACACATGAAAAAATGCTCATCATCACTGGTCATCAGAGAAA
TGCAAATCAAAATCACAATGAGATACCATCTTACGCCAGTTATAATGGCGATCATTAA
aaagtcaggaaacaaccaatgctggagaggatgtggagaaataggaatgcttttacactg
ttggtgggagtgtaaattagttcaaccattgtggaagtcagtgtggcaattcctcaagga
tctagaactagaaataccatttgacccagccatcccattactgggtatataccccaagga

 3.05 PlyA -  59070  59065    6                               1.05
 3.04 Term -  63188  62884  305  0  2   60   43   159 0.012   2.95
 3.03 Intr -  69190  69081  110  0  2  101   71   105 0.033   9.11
 3.02 Intr -  69360  69257  104  0  2   55   94    19 0.406  -2.75
 3.01 Init -  75591  75430  162  0  0   52   55   115 0.261   4.38
 3.00 Prom -  75890  75851   40                              -6.85

 4.01 Init +  82618  82747  130  0  1   54   21   103 0.303   0.56
actaattcaggtgaacatagttaagtttatcctgaaaggctcagcaaacacatatttttc
ttttgtagctgtgcaatatgtaaactgtcaccagttggtggcttttagtagcgctcccca
ttgggaccagagatatctagctacagcttatggaagggcgttggccagaagctgccagat
ATGGGAAGAAGGAAGCATATTGTGGGCTCTAGAAATAGGAAGCTACCTACAAAATTATAT
AAAGAGACTATTCTGAAAGCACGAAGACCTAAAGTGACAGCTGTTTATGATGACAGCAAG
AAGGGCAGAA
gtatgcaacaaagaaaatggagctgagatattaaaaggaatgaacaacacttaacctaat
cccaaaaggaactatgggaagaattagcctggggtattcatctaccacataaacaaagca
aaaacaaacaattgaaatttttcagattctttagaaggaaagaaagacgagtattgttaa

 4.02 Intr +  85122  85201   80  1  2   74   74    47 0.367   0.25
catttattcaggacgaatagtgtgcttttatgagtatgatctatttgtgccctgagtcca
ttttcctattagtgtctttttgtcagttgatttgaaagtgggtttctatatatggtagtt
ttaccctggcttcagtccctgaaaatgaaattattcatttacatacaatttattcttcag
ATGACAATCAAAACAAAACACATGATAAAAAAGAGAAGAAGATGGTGGTTCAGAAGCCCC
ATGGGACTATGGAATACACT
gtgagtataaccaaggtggtataaatgtttgttaatagcactacatttatataatggttt
tccctgacacatcctgccccttggctgcattcctcttgtgtacccattaaacaatcaagc
ttcttaagaccagttttaggtcatttctttttcctccatattttctccctggtcaatctc

 4.03 Intr +  88496  88603  108  1  0   76   91    40 0.856   2.66
taagactttgctgtaaaatgattttattaagaattgacaatgtattcattctttcttata
gtctatcttgatggaactattagtttgttatttattcatattgcagataaattaatagta
tctatcaaaagtaattttttttgctttatttattgactcttacctgtttgattattctag
GCTGGAAACCAGGACACCCTAAACTCCATAGCACTGAAATTTAACATCACTCCCAATAAA
TTGGTGGAACTGAATAAACTTTTCACACATACTATTGTTCCAGGCCAG
gtaattatactcttactggatataactctagaaattctgcatttatcttttattgccgtt
ttcagtgcctcactattgtttgtcacaggattatgataaatgataatgtgctttggttca
atattttctctcctttatttttatttatttattttttgagacagggtcttgctctgttgc

 4.04 Intr +  91323  91436  114  2  0  122   42   125 0.999  11.02
ctgagtatcatttcatggattagtctagaaaaccgtaagttgcttatgagtttcttgaaa
gcaacctaggtcgtaatcatgcactgaacatgatactgtgtagagaataacttctccaaa
cactcactagtggtttgcctggttgctggtactcacccatctgttctctcccattctcag
GTCCTTTTTGTGCCAGATGCCAACTCTCCTTCCAGTACCTTAAGGCTATCATCATCCAGT
CCTGGTGCTACTGTCTCTCCTTCATCATCAGATGCAGAATATGATAAATTGCCT
gtatgtatattatgcactgaagttcatttttattaaagagacttcttttaagttgtagaa
ttcaacatgttatttttcacaagattacatctgaaattctccctagatggttgagattag
gtaattggagaatgcatcctctccaagggaaacttattcacatttaaggtttcaaaggca

 4.05 Intr +  92659  92784  126  0  0   40   71   166 0.998  10.06
tgatttgggtatctgttattacatttgtgatatttttgaaggacagaggatatttgcctt
tttaatgttccacttaaatagaaatagtatactcacagggaatttatggggcttgattta
tacacataatttgtttgaaaagtgcttttatttgattttgaaattttttgctttcacaag
GATGCTGACTTAGCACGAAAGGCCTTGAAACCCATTGAAAGAGTCTTATCGTCTACTTCT
GAAGAAGATGAGCCAGGTGTGGTGAAATTTTTAAAAATGAATTGTCGATACTTCACCGAT
GGAAAG
gtatatagcaatgtaatttgtttcctttccttgaaatctatgaaaaactaaacaaagtta
caaattactggaacagaggctacattaaaagatcttacccaaagtgtcaattttaggttt
gacaagcatccattagttttcttctgttggatgcctggaattttacttactgaggtaaat

 4.06 Intr +  95392  95576  185  0  2  115   60   199 0.946  17.46
cctagcattgcatttcttcagcctgtttttctggtcctcacaaaggggatgtaattgtca
cataggatactgtggttcacaaagtccatggagtggccatctgagttaattaaagctctg
tggtagttgctgaaagcatttctgcctgaagtgattctgtcctgttgctttctcctgcag
GGTGTGGTTGGCGGTGTTATGATAGTGACTCCTAACAACATCATGTTTGACCCTCATAAA
TCTGATCCTCTGGTTATTGAAAATGGGTGTGAGGAGTATGGTCTCATCTGCCCCATGGAA
GAGGTTGTTTCCATTGCGCTCTACAATGACATTTCTCACATGAAGATCAAAGATGCCTTG
CCATC
gtaagacatttatttgtttaccaggaaaaaaggggtgttgagagagctaaatgtagctta
aaaatgagggcatttgcatgattgagggattgtgtagaggtgattttgaagatggaagac
ttgtgcactgaagaaaatgagaaaaatgagaagaaatgaaaagaataaaatcaatgatgg

 4.07 Intr +  99205 100214 1010  1  2   91  121   988 0.879  91.83
gaaatcatttgaacataaatttaagttgtgatatatttatgtattggtttttggttgagt
ttctgttttgttttttgcctttcctccattttgtttttggttttatttttaacattccat
gtgcacccaccatttctcccccaacagtgacctacctcaggatctttgtcctctgtacag
GCCTGGAGAATGGGAAGACCTGGCTTCAGAAAAGGATATCAACCCATTCAGTAAGTTCAA
ATCTATCAACAAGGAAAAACGACAGCAGAATGGAGAGAAAATTATGACTTCGGATTCCAG
ACCAATAGTACCTTTGGAGAAGTCCACAGGACATACACCTACAAAGCCCTCAGGCAGCTC
TGTGTCAGAGAAATTAAAGAAACTGGACTCCTCTAGGGAGACATCCCATGGTTCTCCCAC
AGTGACTAAGCTCAGCAAGGAACCTTCCGACACTTCTTCTGCATTTGAATCTACAGCCAA
AGAAAACTTTCTAGGGGAAGATGATGATTTTGTTGACTTGGAAGAACTTTCTTCTCAAAC
TGGTGGTGGAATGCACAAAAAAGACACCTTGAAGGAGTGCCTTTCTCTTGACCCAGAGGA
ACGAAAGAAAGCTGAGTCACAAATAAACAATTCTGCCGTGGAAATGCAGGTGCAGTCAGC
CCTAGCCTTTTTGGGAACAGAGAATGATGTTGAACTGAAGGGGGCGCTAGATTTAGAAAC
CTGTGAGAAGCAAGATATAATGCCAGAAGTGGACAAGCAGTCTGGTTCGCCAGAAAGCCG
AGTAGAAAACACACTGAACATACATGAAGATTTAGATAAAGTTAAACTCATTGAATATTA
CCTGACTAAGAACAAAGAAGGGCCACAGGTATCTGAAAATTTGCAGAAAACAGAATTAAG
TGATGGAAAAAGTATTGAACCAGGGGGAATAGACATTACCCTTAGTAGTTCTCTTTCCCA
GGCGGGTGATCCCATAACTGAGGGCAATAAAGAGCCAGATAAGACCTGGGTGAAAAAGGG
AGAGCCCCTCCCGGTAAAACTGAACTCTTCTACAGAAGCAAATGTGATTAAAGAGGCTCT
AGACTCCTCTTTGGAATCTACTCTGGACAACAGCTGTCAAGGTGCACAAATGGATAATAA
ATCTGAAGTTCAGTTGTGGCTGTTAAAGAGAATTCAGGTACCCATTGAAG
gtaagctgtttttctttaatgcctttatattctgttgcataattgcctttctacaatttg
cacatgtaatacccacattagtacatttatttgaaaacagtattttctcaatagagtgta
tctttgctgatagcattaacaattggggagaaaatttacaagatatggtatctattttgg

 4.08 Intr + 100875 101043  169  1  1   44  105   197 0.716  15.08
gctttttccttgtgtgctaaagaaggcttgaaaaatttattagtcctgatacgatgttgt
aggatgtttctgcaatgttttgactaagagaggattgtgcactattttttttaagttgaa
aaattctgctattaccaatattgtcaatattgaggaacagttttttcgtgtgtgattcag
ATATACTTCCTTCAAAAGAAGAAAAAAGCAAGACCCCACCCATGTTCCTGTGCATCAAAG
TGGGAAAACCAATGAGAAAATCCTTTGCCACTCACACTGCAGCCATGGTCCAGCAGTACG
GCAAACGGAGAAAGCAGCCAGAGTACTGGTTTGCTGTTCCTCGGGAGAG
gtgagtatgggctacaatggaaagtctgtgggtctgttaggtttggatggcgttttgata
ttctttatcttaaaatacttaattttattcttgaataagagctttatctgaattgtagat
tttagaattctagaaggatattatttaaagggactttctgctaaatggtggttttaatat

 4.09 Intr + 125566 125713  148  1  1   78   83   162 0.009  14.02
tatttgttggctcttaattttgagtatggaagtagagataaccttgataatgggaaattt
tcaaattagtaaaatggatttgccaagcagggaaaagatggtttatgtactgaagtccac
actagcacctgccaagaaagtggacatggtgttaacatctgtcacaaacgtgtttttcag
GGTGGATCATTTGTACACATTCTTTGTTCAGTGGTCTCCCGATGTCTATGGAAAAGATGC
CAAAGAGCAAGGCTTTGTGGTGGTGGAGAAGGAAGAACTGAACATGATTGACAACTTCTT
CAGTGAGCCAACAACCAAGAGCTGGGAG
gtgagcacttgggcagggttagaccgtcgtagttcctaaggtacagtaagcagtctcgca
ttcagattccatgtaacaggctggtaagaaactagagtccctgtgcacctatgaaattac
agaggaaaataactttattcctccgtttgaaaaaaaacaccaccaccagcaccaccgcta

 4.10 Intr + 131176 131301  126  0  0  100   80   209 0.982  21.26
taattgtgcatttgttctgaaactgaaaaattagccatttccccaaagtcctgttcagtt
gatttcctgctgccgaagcgtcaccttttcaagcacgggtgtccctagagtgatttttta
aattagcagttagaagaaaagccaataagttatttttcttggcttgttttctcatttcag
ATCATCACTGTTGAAGAGGCAAAGCGCAGGAAGAGCACATGCAGCTACTATGAAGACGAG
GACGAAGAGGTGCTGCCTGTCCTACGGCCCCACAGCGCGCTCCTGGAGAATATGCACATC
GAGCAG
gtgggctcgccctggccaccaagggtgggggttcctaggctttaagaaatatttcccttg
gccaggtacagtggctcatgcctgtaatcctcacactttgggaggccaaggcaggcggat
cacttgaggtcaggagtttgagaccagactggacaacatggcaaaaccccatctctacta

 4.11 Intr + 132915 133067  153  2  0   75   94   201 0.999  18.75
taaacactgtcaaatgatcattttcttggtttagaatagcaaatatttgccagaataagg
aggggcactatgtgagtgtatgatactgagtttgaataacaggcatttgttttgtgccac
atgttcgtgagcaatttgtgggtgaaccttctgtttacatctcttcctttggctttgtag
CTGGCCCGACGCCTTCCTGCAAGGGTGCAAGGGTATCCATGGAGACTGGCCTATAGCACG
TTAGAGCACGGGACCAGCTTAAAGACGCTCTACCGGAAATCGGCATCACTAGACAGTCCT
GTCCTATTGGTCATCAAAGATATGGATAATCAG
gtgaggcctgtccctctcataaagaatattttttaataatttttcaaaattcccaacagt
agagagactagtaccatatacttccatcacccagattccacagttaacaggattttgcct
tctgtgtcttttatctttgttttttctctgctgaaatattttgaagtaaatcccaatcat

 4.12 Intr + 137896 137991   96  0  0   75   77    52 0.787   2.09
ttagagctggggatatttgtttattcttttattggtggtctttttaagtttgagtgccaa
tttagtaataatctttgctgaaatagatctcagaacatgatgtatcaaaaatattccaga
aagccttgctttggggatttaggtttgaatgtaggtaacatttctgttttcttttgacag
ATTTTTGGAGCATATGCAACTCATCCTTTCAAGTTCAGTGACCACTATTATGGCACAGGC
GAAACTTTTCTCTACACATTCAGCCCTCATTTTAAG
gtacctagataggagaaatatccaactcccatatgtcacagtgtcctcagttggggaagg
ggataggcattggggcagctagctgtcctgtaacttctcctgaactgactccgggctggg
tcagccctttatgactgtagctcgcaaactgcttagcgtccctggccttctgggctgctc

 4.13 Intr + 138407 138480   74  1  2   97   86    34 0.900   1.39
cttccttcgtaaccccttgggagatctcatcctggtgtgggccaggtctggcagtcagga
acttcctccgtcaatggggtgaggtggttcccttttacatatagatactatttcatattt
cctcattgctaattctccagattaaaatgtctgttttcttttttgtgtttcttccccaag
GTCTTTAAGTGGAGTGGAGAAAATTCATACTTTATCAATGGAGACATAAGTTCTTTAGAA
CTTGGTGGTGGAGG
gtaaggttttttttgtttttgttttcttattgttattttaccacctgacctgagtgggtc
tgttttgacctacgtagttaaaacttcggtgtcaggttattttagctagtccatgtgctt
agatgaattaggacagaggctaacacagaatggcctaactaagaatcaaagatagaatat

 4.14 Term + 138869 139004  136  2  1   88   44    89 0.893   1.01
cttgtcttttaggaagactggtcatttaaatgaaataaaggaaatgtatcctggttttat
aagcagtttagaattttgcctgtcagtagtataaaggaaagaagatgggggcaagagaga
atagtgtgtcatgtaacatagaagtgtttttacctttttttttttttttaaccttttcag
GGGACGATTTGGTTTATGGCTAGATGCTGATTTATACCACGGACGAAGCAACTCTTGCAG
CACTTTCAATAATGATATTCTTTCCAAAAAGGAAGACTTCATAGTTCAGGATCTGGAGGT
GTGGGCATTTGATTGA
aattcagactgccttaaaatataacattaaaaagactgggttcgatcagccctcctaaag
ctggctggaaaaagaagccccagcccagcctgcctcatcccaccccaatgcttcctttct
gccatcatctcagagcatgatcacattgcagaaagattctggaaggtccatgtagagggc

Predicted peptide sequence(s):


>NCOA7_1|GENSCAN_predicted_peptide_1|218_aa
MPCCDTTVWRCPTDLKSGAAEAAENNKNLTNCAYSKVSLGNDMVPIWIVVKCSFFPDLNN
RSSSWAESGRDLAWTALKYAAPENSALHCQKPAFKAFGTSACPQLNASSALPTTTPTKMP
QERVPQPMRITIKRKIKPHGSGPMATINSSCVPSGVAFNRGAHHLLPPPVPGTPSWMLPN
CSHYSNKNIAVGPSSRLLAETRENLGGGRFASAAGPVP

>NCOA7_1|GENSCAN_predicted_peptide_2|193_aa
MEEGATSNIALEAGKSKKRTSNGEDGPVDALISAWWIKDLNVRPKTIKTLEENLGNAIQD
RGMGKDFMSKTPKAMATKAKIDKWDLIKLKSFCTAKETIIRVNRKPTEWEKNFAIYPSDK
GLISRIYKELKQIYKKKTTPSKSGQRNEQTLLKRRHLCSQQTHEKMLIITGHQRNANQNH
NEIPSYASYNGDH

>NCOA7_1|GENSCAN_predicted_peptide_3|226_aa
MSHTVLKSKMQGLKHREVTNLIKRFALESTTALSMEKVLLVCGNKSGFGAKEGRIHHRVD
GKLNVEQTKSKEFPFPLTFSSNGSPLTTRLEPPKAAVNWDALDLRSDAPSSGREHRLGMG
LRNTPELEKTILKLIWNQKRAQIAKEILSKKNKSEGITLPDITLPNFKLYYKAIVTKTAW
YLYKCKCIDIAMEQNKEPRNKAKYSQPTDLRQSIQKHKLGKGNSIQ

>NCOA7_1|GENSCAN_predicted_peptide_4|884_aa
MGRRKHIVGSRNRKLPTKLYKETILKARRPKVTAVYDDSKKGRNDNQNKTHDKKEKKMVV
QKPHGTMEYTAGNQDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTL
RLSSSSPGATVSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCR
YFTDGKGVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHM
KIKDALPSPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPIVPLEKSTGHT
PTKPSGSSVSEKLKKLDSSRETSHGSPTVTKLSKEPSDTSSAFESTAKENFLGEDDDFVD
LEELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQSALAFLGTENDVEL
KGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSE
NLQKTELSDGKSIEPGGIDITLSSSLSQAGDPITEGNKEPDKTWVKKGEPLPVKLNSSTE
ANVIKEALDSSLESTLDNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKEEKSKTPPMF
LCIKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKD
AKEQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEEVLPVLRP
HSALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDM
DNQIFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGG
GRFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWAFD