GENSCAN 1.0	Date run: 16-Jan-104	Time: 17:03:31

Sequence MYB_1 : 40147 bp : 40.44% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1295   1317   23  1  2  107   97    30 0.843   4.87
ctcctccttctcctcctcctccgtgacctcctcctcctctttctcctgagaaacttcgcc
ccagcggtgcggagcgccgctgcgcagccggggagggacgcaggcaggcggcgggcagcg
ggaggcggcagcccggtgcggtccccgcggctctcggcggagccccgcgcccgccgcgcc
ATGGCCCGAAGACCCCGGCACAG
gtaacggggagccgggcgggcggccgagggcgggggcgcgcgggggcgcgcggggcgcca
ggctcccgggagcaggtgggaattcgttccgggatcatctgaggggctgtcagaccctcc
gaggacctggagcccctgcctcggcagcagaagccgctccagagactgatgaatggaaga

 1.02 Intr +   3163   3315  153  1  0  102   -3    95 0.255   0.07
aacctgcctcaggggaagagaaacccgactgcgggctcggagccgtttcttgcaagggcg
agcgtcaactcggcagggattatattaaccaggtcagcgaaatgagtttgaacccctccg
aatcacagtagcggccacaaggcacttcctcccgctcccctccctcttcctaacccccag
CACCTCTTTTCTTTTTCGTTTCTTTGCACGGTTTGTTTCCTTGACAGAATGTAACATTCA
TAGTTGTACTCTTGTAACCACACCGGGTCTAGCAGGTGGGGAGTCGAGTGCATCAACCCT
GAAATCAGCCTTTGAAAATCCTCTGACTGTTGG
gtctgagatcttgtcagagcagataaaggaaaagttatttcaggttccttagtagaaatt
aatcatgcttctaggacgacttagagcaagcaaatcgcatgcaaagttcaaaggcgagcc
tgggtggccagcctggcagggaaactcaggagctgggcgcgtgagcagccccggactcgc

 1.03 Intr +   5684   5801  118  2  1   98   78   150 0.992  14.55
aaccagtttacaatactagagcaacagaatgcagcaaacaatcttgttgtgcaagttttc
aaagttttgtcttcataacctttgaaaagattgttgaggagttttgtgtaagttttgtaa
tccagtagtagtctaaatcctcttgtttcagcccacgtctacccattcttatttctgcag
CATATATAGCAGTGACGAGGATGATGAGGACTTTGAGATGTGTGACCATGACTATGATGG
GCTGCTTCCCAAGTCTGGAAAGCGTCACTTGGGGAAAACAAGGTGGACCCGGGAAGAG
gtaactaatcattttatcaagacgcagaaaatagatagagtgtataatttataaaaaaca
aaatttcaactaaactacaggtgctcaagctcattagcaggctccttgagatcttatcct
agcccgcatgtgcagcgtgccctatgccccccacttcattatattatccatttccacact

 1.04 Intr +   7615   7686   72  0  0   34  131    93 0.977   6.88
aactctggtctgattctaaataaatctatactcccaagtccgtatattacattaatatct
cctgtattcggatactttagagagactttttattctagattcgttccctcattcacttta
acttgaacagagttatatagtaaataactgatatcctaggattacctttaaatgtcttag
GATGAAAAACTGAAGAAGCTGGTGGAACAGAATGGAACAGATGACTGGAAAGTTATTGCC
AATTATCTCCCG
gtaagttagtaagtttttcttataacgaaaggaaagcttctcccaaagatttctataaaa
tattctaggaggagttattaagatagtgtataatttactcacatttaagaagtgggagaa
atgccctacccataacttatattttatattataatgcatataattaaattattagaattt

 1.05 Intr +   9572   9664   93  1  0   25   89   111 0.929   4.14
tatattacttgcatgttctgtagcctgtaagtaatgagggatagatgggctctaaacatg
ctctaaaatgttcttaaatattttcactgcatatggtctatgtgtgattcctattacaac
aaaaaattcacgtgcttatcacatcatatctttatggtggtgcatactttatttgtctag
AATCGAACAGATGTGCAGTGCCAGCACCGATGGCAGAAAGTACTAAACCCTGAGCTCATC
AAGGGTCCTTGGACCAAAGAAGAAGATCAGAGA
gtaagttctttcttcattggtgtgtgactcataattaagaatattcccaaaatgctaata
ttttcctatttgaggaagcaggtaaaatgggcaaacaggaagtagaggactctattccca
tatttccagtgaatgaaagcaaattttggaaattttctaaagatcttgtaacactgaaga

 1.06 Intr +  11718  11800   83  2  2   73   57    29 0.794  -4.18
cattttccactctcgtctctgtctgattcagaaaacaattggggtggctttcaaagagta
ggaggttttttggtctcagaagttctcactagtgctttgagagataaagagtgaagtatt
cttcatcagcagcatcttatcatccaccagacttcaccatgtccctctcgtggtgtgtag
GCCCTGCTGTGCCACATTCAAAGGAGTAATTTCCCCAAGGCAGCTGGAACTTTACATTGT
GTTGGAGTCTTGTACCGCGACCG
gtcagaataaacatgaagcgttatcgtattgaaaatactcctttaccaaggaaatggaat
ggttaaaagatactgatatttctagaaaacgacatgcattccagattgtgtaactaagag
aaatctaactaggcaatagagaaagcctgatctcagagggtggagaagaaggaaacaatt

 1.07 Intr +  12105  12339  235  0  1   55   75   260 0.627  18.17
ctaactaggcaatagagaaagcctgatctcagagggtggagaagaaggaaacaattaaaa
agagaaaacaactaataggcccaagggaaaggtctctgttagaaacagttttctgtcaat
tcactttaatctgaattgaaatttttgtttgtgaaatttgtgtgatatatttctgtgcag
AACTGATAATGCTATCAAGAACCACTGGAATTCTACAATGCGTCGGAAGGTCGAACAGGA
AGGTTATCTGCAGGAGTCTTCAAAAGCCAGCCAGCCAGCAGTGGCCACAAGCTTCCAGAA
GAACAGTCATTTGATGGGTTTTGCTCAGGCTCCGCCTACAGCTCAACTCCCTGCCACTGG
CCAGCCCACTGTTAACAACGACTATTCCTATTACCACATTTCTGAAGCACAAAAT
gtaagccattcctgtgaatctagtttaatgagagagacggttagtttagctccaggtaat
aatcatactttgcagttgtatacttttcagagaactttcctgagcatgatcatggccagt
cttcacctatgccctttgaagtagatagggtgtaggtatggtgtgttacccctggtttat

 1.08 Intr +  13619  13699   81  1  0  106  110    53 0.993   8.22
tagccattttaaaggcctggctaaatttcacattaaaaggttttaaaaatttgtttagtg
tattttatcagtaaagtgttttttttctctcagtcccagaacgaaacctcaggaagccaa
gtcccctgaagcatatgtagccctgaatgacgtggcctttgttttgtcttttgcatctag
GTCTCCAGTCATGTTCCATACCCTGTAGCGTTACATGTAAATATAGTCAATGTCCCTCAG
CCAGCTGCCGCAGCCATTCAG
gtaagatcattgatcattcactgttcaaagcaccacttttaagaaatgcttatttctttc
atctaaacacatatttttacctgagcaactaaagtaaaaaggaaagggaacatggagagg
agagcagagtcttggccagcaatctattaatcttgtcttctagaatgagtttgctctgga

 1.09 Intr +  14137  14241  105  0  0   73   63   129 0.887   8.39
tcccttaagtctgaaataacattcacaaagatttctgcaggagccaaatttggttggtgg
tgttgtcacagtgaggctctttgggctgtgcggcacctcatgaccatattggctacaccc
attgtatttgcagcttccaatcagacctttgtctttatttcccttactttgtaatttcag
AGACACTATAATGATGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAATTAGAATTGCTC
CTAATGTCAACCGAGAATGAGCTAAAAGGACAGCAGGTGCTACCA
gtaagactgtcatcatgtgcttgaatgaggggatagcagctttgcctcagtttacctaag
cgctcttctcttctaaatattacacttagcaaggctccatatatccattcagaatgtctc
aacacaagaagttgcttgtagtaaaatgtagttggtatcagattatatgctgattaaatt

 1.10 Intr +  15529  15783  255  0  0  104   84    91 0.982   7.02
ggtcttgcattgataaaaggaaacatcttgacaactgtttcataggcgtaagtttgggat
gatgcaactactcttatctttcctccaacagcatctgataccttgtgcaacttcattgct
aagttccttctccctttcttctgtcctctctttatttctacacccttcccccttccttag
ACACAGAACCACACATGCAGCTACCCCGGGTGGCACAGCACCACCATTGCCGACCACACC
AGACCTCATGGAGACAGTGCACCTGTTTCCTGTTTGGGAGAACACCACTCCACTCCATCT
CTGCCAGCGGATCCTGGCTCCCTACCTGAAGAAAGCGCCTCGCCAGCAAGGTGCATGATC
GTCCACCAGGGCACCATTCTGGATAATGTTAAGAACCTCTTAGAATTTGCAGAAACACTC
CAATTTATAGATTCT
gtaagtagaattgtgaagggaagttaacgattctggaagataaattagaaaacccatttc
ttaaatcattgccattttctatagccaagctgttattagcatatattaatgtaaaggtag
aagtatgattttcatcttcatgaatatgttttttcaaagatctgatttcatagcctaccg

 1.11 Intr +  16742  17104  363  1  0   67   75   202 0.984  11.26
ccactagaccctgctctactgcagtataatagagcaactgctcatcttgaagctgttgct
caagaagccaaaccaacgggcctagtgtttgctttgcgttgagcatctctctctcagtgc
tgtttcaggtgatgatggcacacactatctcaaagttctgtgcctcccacattgtttcag
GATTCTTCATCATGGTGTGATCTCAGCAGTTTTGAATTCTTTGAAGAAGCAGATTTTTCA
CCTAGCCAACATCACACAGGCAAAGCCCTACAGCTTCAGCAAAGAGAGGGCAATGGGACT
AAACCTGCAGGAGAACCTAGCCCAAGGGTGAACAAACGTATGTTGAGTGAGAGTTCACTT
GACCCACCCAAGGTCTTACCTCCTGCAAGGCACAGCACAATTCCACTGGTCATCCTTCGA
AAAAAACGGGGCCAGGCCAGCCCCTTAGCCACTGGAGACTGTAGCTCCTTCATATTTGCT
GACGTCAGCAGTTCAACTCCCAAGCGTTCCCCTGTCAAAAGCCTACCCTTCTCTCCCTCG
CAG
gtagaacacaatttctgcacagctgttactcattttcaacagacacctgagccttaataa
tctagaaactaatacttcggaacaaatgactaattactgctgcctttgctgatttcattc
tgtcgttgaatctagctgttgctaagttatactgcctcccaaagtttaggctgtctgcag

 1.12 Intr +  18689  18831  143  1  2   57   75    58 0.973  -0.37
cctgggtgctcaattgaaataaaacaataccctagtcaatataacatgcttgttagcatc
tttattatttaatatagtgggtcaggaaaacattcttgttatctaggtgtgatttttaaa
ttggggagaataaagaattaccatctaatctaagtattttttctttctctccatatttag
TTCTTAAACACTTCCAGTAACCATGAAAACTCAGACTTGGAAATGCCTTCTTTAACTTCC
ACCCCCCTCATTGGTCACAAATTGACTGTTACAACACCATTTCATAGAGACCAGACTGTG
AAAACTCAAAAGGAAAATACTGT
gtaagtctttggttcaggaataaaatgatttatcttatttacttatatttaattaatgga
atatagttcccagatgtctgatccacttgtatgtgcataattttactgaccatttatata
taatcatgtctattcccacattgaatatatctgtcctgggcatattacaactacctacag

 1.13 Intr +  19866  19980  115  0  1   61   94    84 0.791   5.83
aatatgtgatatgcatattctctttttcttaacgaataacgtgattaatcagcacacccc
aattccatatccggaacagagtttattgtattcagtggaaaaatgttaaatgtaacaggt
aaagccatgtagggacatttattcttttgtattgagccactgcttgttttctttttaaag
TTTTAGAACCCCAGCTATCAAAAGGTCAATCTTAGAAAGCTCTCCAAGAACTCCTACACC
ATTCAAACATGCACTTGCAGCTCAAGAAATTAAATACGGTCCCCTGAAGATGCTA
gtaagttctagaaaagtttttggatttcattggtttattagtcccattaggagttctctc
tgatgcaaaaatacccactcttccgtttagcctcagacaccctctcatctagtagaagat
ctgcaggatgtgatcaaacaggaatctgatgaatctggaattgttgctgagtttcaagaa

 1.14 Intr +  20071  20196  126  0  0   53   82   176 0.856  13.46
tcaatcttagaaagctctccaagaactcctacaccattcaaacatgcacttgcagctcaa
gaaattaaatacggtcccctgaagatgctagtaagttctagaaaagtttttggatttcat
tggtttattagtcccattaggagttctctctgatgcaaaaatacccactcttccgtttag
CCTCAGACACCCTCTCATCTAGTAGAAGATCTGCAGGATGTGATCAAACAGGAATCTGAT
GAATCTGGAATTGTTGCTGAGTTTCAAGAAAATGGACCACCCTTACTGAAGAAAATCAAA
CAAGAG
gtaaacacgcaaccctttggaagcaacaagctgagaatcctgccccctttattccttgtg
tgcagcttgatgtgtctgccattggcactgtgcaacaccacgacttttcgtgcaagattt
tcatacaaggtgcagcgaaaaggtactgccagactgtaggcatcatcaacctttcctttg

 1.15 Intr +  21420  21530  111  2  0   60  131    52 0.973   6.36
caaatttgccatcagtgtttctttgttgaatccagaagatagagcaaattgagctgatag
tgtaagttagcaacatagttttataaaagtatttgagggactggccagaaatatactcct
gactgtacatgtttcataggaagttctagaaacaacaaagcactttctatatgcttttag
GTGGAATCTCCAACTGATAAATCAGGAAACTTCTTCTGCTCACACCACTGGGAAGGGGAC
AGTCTGAATACCCAACTGTTCACGCAGACCTCGCCTGTGGCAGATGCACCG
gtaagtacgtgtgcaccagcccccaagttgttatgtgacactggtgcctcatgaaatcct
gtgtgtggcatagggctgctgcggtttcagcactccctctttaacacatcttatttctaa
atgttctcctgcacatgatttttaaaaaatgattattaatgtagagtataaagttgagat

 1.16 Intr +  22998  23105  108  2  0  112   91    61 0.971   8.36
gttcagacatagttgatttctccttttagctcatagtggggagaatttctggcagatgac
tgcatttttttatgctaatgtgtatcatctcatagtaatctactctccacagtgttagaa
aaatgtggctctcatattatccaacctcatttaaatttcaaattattctcttccctttag
AATATTCTTACAAGCTCCGTTTTAATGGCACCAGCATCAGAAGATGAAGACAATGTTCTC
AAAGCATTTACAGTACCTAAAAACAGGTCCCTGGCGAGCCCCTTGCAG
gtaattactattccaacattggtattttaaaattcattcactgaaaaactgtcatctttg
gtggtggtggtggtggtggtgatggtagtgctggtggtctgtttttcgttttcaacattt
tagacataggggagtaatgcttttatacaattcttgatgtctagaaaaatccaataattc

 1.17 Term +  37645  37761  117  0  0   79   53   179 0.965  11.06
tctgatcatccatatcccttaagaacaccggatttctgggggccagggaggtaagattct
atctgacaaagccttcctggtgtcaaccacttgccatctgttggtcagtgctggccctgc
tgggtctatagaatgagcttctttgtctgacgctcctgttgccatccctttctccatcag
CCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGACATCT
TCCAGTCAAGCTCGTAAATACGTGAATGCATTCTCAGCCCGGACGCTGGTCATGTGA
gacatttccagaaaagcattatggttttcagaacacttcaagttgacttgggatatatca
ttcctcaacatgaaacttttcatgaatgggagaagaacctatttttgttgtggtacaaca
gttgagagcagcaccaagtgcatttagttgaatgaagtcttcttggatttcacccaacta

 2.02 PlyA -  38285  38280    6                               1.05
 2.01 Term -  39302  39174  129  2  0   97   42    92 0.654   2.70

Predicted peptide sequence(s):


>MYB_1|GENSCAN_predicted_peptide_1|766_aa
MARRPRHSTSFLFRFFARFVSLTECNIHSCTLVTTPGLAGGESSASTLKSAFENPLTVGI
YSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANY
LPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRALLCHIQRSNFPKAAGTLHCVGVLYRD
RTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPAT
GQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRI
KELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTP
SLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFF
EEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKVLPPARHSTI
PLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDL
EMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHAL
AAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPT
DKSGNFFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKN
RSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM

>MYB_1|GENSCAN_predicted_peptide_2|42_aa
AAFQVPSGLHPVALLAPAHICGISTFVNEFPLQHPHSNAARP