GENSCAN 1.0	Date run: 16-Jan-104	Time: 16:17:02

Sequence ICK_1 : 62870 bp : 40.94% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    897   1089  193  2  1   42   55   159 0.592   7.19
aaaggtaacatgaaatttgctgtttaaccactttgaatacaattcagtggcattgattac
tttcacaatgtcgtgccacctcaactacgttttttcaaatcagaaaaatgttttcacaac
gattatctttaatttaatgtgctcagaacgtccatcgacagcctccatttctaagtcttg
ATGGTTGATCGAGCCGATCTGCAACGAGGCGTTCGTTCGGAGTCGGAGATCGCCTTGCGG
TCAGCGGGGGTTAGGGGTCCCTGGGCGCTGTGCTGCCCTCGGCCCAGAGCTGCGCCTGGC
GGCTCGGCCGCGCGAGCCAGGGCGAACAGGACGCAGTGCAGGGACGCGCAGGGCCAGCGA
GGGGAGCTGCAGG
gtaacttttcccagggaaagcggccggtcgtccccagtagaagccacccagccttttgtt
tgttttcctgccggaggctggaaaacggccgggttcctgctgcactaccatgcgccgtgc
ggcccgtgcgactcgccggacctcgcgggcgtccctgtacggagccctcggccggtccta

 1.02 Intr +   4092   4174   83  1  2   84   73    32 0.314  -0.26
ttagtaagtattatcctgcccttacttaaaatggcttgagcttaggttattcctggctgc
agctctgcttctgggatctgttgctgtttttccatctgaaccttgccaggaacactactg
cttaattttttttttttatactgctcctcttgcagcagtctcctccatttcattttgtag
GATCTTGCAGAGTTGGAGTGGTACCTAGCCGTTCTATTGATGTCTGCCCTTATAAAATGC
ATTTTTCTGCTTGTGGGATCTAT
gtgagtgtgtgtatttgcctggtggttccttgggagaattctggatataatgacctctct
gtgtatgttgatctgaaagcctgtgaatagtatctcatttaactgttgtctttcacctgt
ggtctttgatgactgtggctttctgagaagggcctatgtttagagtattagaactctcct

 1.03 Term +   8980   9129  150  0  0   63   48   117 0.536   2.13
gaaagagaaggaatcgatgtttaatgtttactggggcctggctgaggcactggggcactt
gtgcatctcttgaaagaaaggtgtgtagcatacagggtccttcggtggcactgtcttctc
cgctaacctttgttcatgtgatgcaaaaagcagaaacatttatccttttttttttcttag
ACAAATGCTAGCTCAATTCCTGATACAGAGTCACAGAATCACACAGCTTTAGAGGAAGAA
ACCACCTTAGAGCAAGTCCCATGCCCTAATTCCACCAAAAGTAAACTCAAGGACCAAGAG
ATGCCCCGAGGCACAGCAGATCAGTGCTGA
gtggaaactggaaccagtccctcactttgcctccactgtgggcatgttggtgctgccaat
ggctccagaggattcgctgatatttgattgcagaatgaagacaattagaacatagccata
tcattcattttcatatttgggctttgagatacaaagtactacttctgttcctgtcatttt

 2.01 Init +  21735  21835  101  2  2   82  106    88 0.042   9.79
ctctgcaggcagaagactgatttttggaaatatgtatttgggagacagtcacgtcctatt
gaataccttgtgctggtgctgccatcgaaaaatctggttacactctggggaggactgcta
ccactgcagaactgaaccacttcggccgtgagatgagtgtccggcctgagcaggcacacc
ATGAATAGATACACAACAATCAGGCAGCTCGGGGATGGAACCTACGGTTCCGTCCTGCTG
GGAAGAAGCATTGAGTCTGGGGAGCTGATCGCTATTAAAAA
gtaagtttgatccttcactgccatgataattttaactctaccctcaccattacccgtctt
tgtaacagttctaaaggggagtgggtaggatgcctagagaagaaccttagataatgattg
ctgtgggttagatgattattgactctgtaacactcatgttagaggtctgaaaacatttcc

 2.02 Intr +  29524  29599   76  1  1   58   83    37 0.003  -1.20
gaaagggctattttaattaaaggattcatctcactggccaaagtgacacttggaggcttt
catgaaggagacagtcttatcagattctgattatccaaaccaacagttttaggtatgtct
gctgtacaagaagagggatgctgcttactaatacaaaattgatttgttcactatcaacag
AACTAGCAATACAAACAGAAAACAGTGTGCACATGGCTATACTCACATGTACGCACATGT
TCCAGGAAGAGGAAAG
gtacatatgtgtgaagatgagtaatcttcacacatataaggccacgcaccattttctgag
ccaccctctcattcctcatccactgcctgactttttgccttcgttgttcttggaaacaga
gggatttctcttgtcttacttcagggtccttccgtctccttctggtcctctgtaactcaa

 2.03 Intr +  30317  30438  122  1  2   83   77    73 0.007   4.07
taaagttattataaatttcagaggtatactattaaactgtcaataaaatataatttagca
catttctgaggttctaaaattagttgtttctttccaagtatacataggattacttttctt
tttcaacaacagattttctctaatatttgttttgttttgtgtttattccttgccttttag
TCTTTAAAGAAGCTCAACCATGCCAATGTAGTCAAATTAAAAGAAGTTATCAGGGAAAAT
GATCATCTTTATTTTATCTTCGAGTACATGAAGGAAAATCTTTACCAGCTCATTAAAGAG
AG
gtacagtttggtcatcattatcttattatagaaataaataggcaaagcagatgtgttttc
tttctgcttttgtgttttctttctctcctttttttctttttttattttttattttttatt
ttattttattattattatactttaagttttagggtacatgtgcacaatgtgtaggttagt

 2.04 Intr +  31827  31906   80  0  2   90   90    44 0.010   3.08
ggaggaaaaacttttttttggcttactatcaaatgtttaatctttttgtttttgtaacat
gtgactatatttggtgtttataaggtagctcccctgtatggacaaatggtattctttagt
atttattatcaaaggatctggcctttgatttataactttgttttcctctgcctcatacag
AAATAAGTTGTTTCCTGAGTCTGCTATAAGGAATATCATGTATCAGATATTACAAGGACT
CGCATTTATTCACAAACACG
gtaggtgattcggagtgttgtgcttttgaagagcagtgaaatgttgttatcaagtagaag
ttgtaggaaacattaatattttttgtagctgactcccagaaaaggttgaagagttgagag
gctgacaatggattttaaaatatattaacttttataacttgatctctgaatttccctcat

 2.05 Intr +  43612  43744  133  2  1   73   23   175 0.550   8.28
agtaatcctatgagaagttcgaaggactctacattatctgtgggatgaatgcataaagcc
tttggtgccatgccagactactttttaaattataactattttgcagagagcaatacaatt
gcaaagaataatacgaagcaaacttgcatttggatttcttctcctctactgtctctatag
GCTTCTTTCATCGAGACTTAAAGCCTGAGAACCTCCTCTGCATGGGACCAGAACTTGTGA
AAATTGCAGACTTTGGTTTGGCCCGAGAAATACGATCAAAACCTCCATATACAGATTATG
TATCTACCAGATG
gtgaataccatttttctcaaaattatttaattgcacttctttaaaaagatatcattatgc
taaggataatattaaagtcacaaatgttaacttttcactaagagaaacagtgcagtctga
aacatatatttatagatatgttggtaatgtacaaggttaaaaatcttgtgttctaaatca

 2.06 Intr +  44470  44641  172  1  1   59   90    51 0.462   1.42
gaagcactacttgtcaacagcagcccacggcagttgccaagttctcacaattccattaca
ccacagtgaactagagagaaaataggaacatatacaccccctcactgagaactgattgtt
atttaatttaatgtctgagtggtggaagcaatagctagcagttaacctttgttcctccag
GTACAGGGCTCCAGAAGTACTCCTGAGGTCTACCAACTACAGCTCCCCCATTGACGTCTG
GGCGGTGGGCTGCATCATGGCAGAAGTTTACACCCTCAGGCCACTCTTCCCTGGAGCCAG
TGAAATTGACACAATATTCAAAATTTGCCAAGTGCTGGGGACACCAAAAAAG
gtaatgatacaaaacaaaggccagtgggccaaagccaacagcttcccatgcttcctccgc
tcagccctgttcagcactggcatgattgagcacctgcccattctaggctctttctcttga
cctcagtcattctccactgcccacgttctcagatacggtcggcttctcttcctcctcctg

 2.07 Intr +  46721  46888  168  1  0   84    5   160 0.875   6.52
ctctattaatctaaatctatgtctcattccatacagtgccacagtagtgaatgtgggtgg
ttaatgaatgtgggtgggtaatgacatggttgcctttccatttggggcacacatgccaga
atacaaacttatatcacagcaattggctgagcaagattttctatcttttccttctttcag
ACTGACTGGCCTGAAGGCTATCAACTTTCAAGTGCAATGAACTTCCGTTGGCCACAGTGT
GTACCCAATAACTTAAAGACCTTGATTCCCAATGCTAGCAGTGAAGCAGTCCAGCTCCTG
AGAGACATGCTTCAGTGGGATCCCAAGAAACGACCAACAGCTAGTCAG
gttttcttccattttcttgttataacgttcatatctaactctgaataatttctatgaatt
gcacaggaaatatttagtatttagtattatgggtgagaaatagtacagaataccactaat
ggtgtactatataaggtatgagaacttaaaatagtttgaaacttactgggtataaagtag

 2.08 Intr +  48989  49309  321  1  0   76   97   287 0.752  23.53
atattttatggtatcttagataagaaaaatcacaaggggtgttaaaaattcaaggtactg
ttttctaattgggctaagaaacagtagtaaactggtcacaatgaaatatagcccagtaat
caagacagtggtaactttcctggctagacttttctcctaaagccttatttgtcattccag
GCACTTCGATATCCTTACTTCCAAGTTGGACACCCACTAGGCAGCACCACACAAAACCTT
CAGGATTCAGAAAAACCACAGAAAGGCATCCTGGAAAAGGCAGGCCCACCTCCTTATATT
AAGCCAGTCCCACCTGCCCAGCCACCAGCCAAGCCACACACACGAATTTCTTCACGACAG
CATCAAGCCAGCCAGCCCCCTCTGCATCTCACGTACCCCTACAAAGCAGAGGTCTCCAGG
ACAGATCACCCAAGCCATCTCCAGGAGGACAAGCCAAGCCCGTTGCTTTTCCCATCCCTC
CACAACAAGCATCCACAGTCG
gtgagcagcccagattcaccagtgagcttcgtgtctgtttattcctcttctgaccccatt
attgtgtgaaatattttctttttcagtatacagggtccagttatggtagatttatgtttg
caacagcatggaattgtaaagacccttggctttggagtgaaagatctaaattcaagttct

 2.09 Intr +  50744  50802   59  1  2   77   81    15 0.449  -3.54
tgaaggatgagtgagacagaaagattgggaatgtgttttctacagttgccccttcagata
agcaatgttatgccccaggagcctcctttgcatagcagagaaagttcagatggagattac
tcatggatgagttctgttaatgccaagtattgctttcccccaccccgtttgtttacacag
AAAATCACAGCTGGCCTGGAGCACAAAAATGGTGAGATAAAGCCAAAGAGTAGGAGAAG
gtggggtcttatttccaggtcaacaaaggattcagatgattgggctgacttggatgactt
ggatttcagtccatccctcagcaggattgacctgaaaaacaagaaaagacagagtgatga
cactctctgcaggcaagtgtgctgctcacatttgtaaacagactgaatctggaattcatg

 2.10 Intr +  51054  51202  149  0  2   83   50   197 0.552  14.36
catccctcagcaggattgacctgaaaaacaagaaaagacagagtgatgacactctctgca
ggcaagtgtgctgctcacatttgtaaacagactgaatctggaattcatgagattatgggt
acatatccgagaatacatactgtctctcgtgctgacccaagccatgctctcttcattcag
GTTTGAGAGTGTTTTGGACCTGAAGCCCTCTGAGCCTGTGGGCACAGGAAACAGTGCCCC
CACCCAGACGTCATATCAGCGGCGAGACACGCCCACCCTGAGATCTGCAGCCAAGCAGCA
CTATTTGAAGCACTCTCGATACTTGCCTG
gtaatataaatgacttggctttactttgattattaataagaaaccctgtccttggaatca
catattcacaaaggttctgttttagaaggcagatactagggggcttcccttcagaactga
ggggaacatcatagaaatatttgctgaagcccaagcctcactttttttttgagttggagt

 2.11 Intr +  53404  53532  129  2  0   82  109    46 0.937   5.85
accagtgagatatctttcctcggacatctgtcagatgacatcatcacagtcagtttttgc
tttgattattgtatcatagagagtttttgacaaattgagttctgcattaattttatcttt
gtagtctagtgtaagattcattgtgtattttgcattttaaaatcatttcttctctatcag
GGATCAGTATAAGAAATGGCATACTCTCGAATCCAGGCAAGGAATTTATTCCACCTAATC
CATGGTCTAGTTCTGGCTTGTCTGGAAAATCTTCAGGGACAATGTCAGTAATCAGCAAAG
TAAATTCAG
gtgagtaatgatcattaacccctaaatggcaaaaagcaaattccctggatgcaggaaggt
gggcacaaggagtcatgggacgggctttggaagcacaggggcctttgtcatctgaaagct
caggcctcttttccagccctatcctcctctctttctcggcagcagtcccttgggactcag

 2.12 Intr +  56534  56656  123  0  0   56  105    80 0.885   6.14
tctttctgacagggtagtatggtgggatgcttggctctgaactcatttttatcatgattt
gctcttttccctaaaagtaaaaacttagtttgttattgctctgcagtgctgtcatttaac
cttgttggtgtcctgggtacatgtctttgtaataatgagctttttgcttttgcaaatcag
TTGGTTCCAGCTCTACAAGTTCTAGTGGACTGACTGGAAACTATGTCCCTTCCTTTCTGA
AAAAAGAAATCGGTTCTGCTATGCAGAGGGTACACCTAGCACCTATTCCAGACCCTTCCC
CTG
gtgagttgtattttaaattattcatgaatttactcaacaaatggttactcaacaactgct
ttgtgccaggcatgttttaggcctgggatccaccaataaatgaaacttgcactctacaga
caataagtaagctaaataagtgctatataacatatagtaagtcagatgcttactgactta

 2.13 Term +  57668  57822  155  0  2  115   42    30 0.726  -1.80
tttggcctgacaactttaaaacgatgtctttaactgcagtagagaagattataagtagga
gacaagatgctcctcttgaactccttattttctcatgtttttgtcaccaaaatgcattta
tttgtactttgcttacattggccccatatcagtcatgccggcctttttctttcattgcag
GTTATTCCTCCCTGAAGGCCATGAGACCTCATCCTGGGCGACCATTCTTCCACACCCAGC
CTAGAAGCACTCCTGGGTTGATACCACGGCCTCCAGCCGCCCAGCCAGTGCATGGCCGGA
CAGACTGGGCTTCCAAGTACGCATCTCGGCGATGA
ctgtctgccttggtgatgaatctcttcctagggagaagcaggatactttccctcagctga
ctggtgttctacctgcaagatgtgcagagggcataaaagcaaatcaacactttatagtta
ttcttctgaactaagacatgtcaatattcttttttaaagtttttttttaaaatattgatt

Predicted peptide sequence(s):


>ICK_1|GENSCAN_predicted_peptide_1|141_aa
MVDRADLQRGVRSESEIALRSAGVRGPWALCCPRPRAAPGGSAARARANRTQCRDAQGQR
GELQGSCRVGVVPSRSIDVCPYKMHFSACGIYTNASSIPDTESQNHTALEEETTLEQVPC
PNSTKSKLKDQEMPRGTADQC

>ICK_1|GENSCAN_predicted_peptide_2|595_aa
MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKTSNTNRKQCAHGYTHMYAHVPGRGKS
LKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGL
AFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLR
STNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSA
MNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGST
TQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKA
EVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRFESVLDLKP
SEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPN
PWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIP
DPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYASRR