GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:16:13

Sequence HIST1H2AB_1 : 2876 bp : 46.73% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +   1193   1593  401  0  2   48   49   590 0.445  46.38
acaccagacggaaggattacatgcaaatgaaggatgcagattctgatttcccattgggta
tttgacattagccaatgggagaattcctcacagcctacctccagtcagtataaatacttc
tctgccttgcgttctaatgtagtttcattacattttcttgtggcgattttcccttatcag
AAGTAGTTATGTCTGGTCGCGGCAAACAAGGCGGTAAAGCTCGCGCCAAGGCTAAGACTC
GGTCTTCTCGTGCAGGTTTGCAGTTTCCTGTGGGCCGAGTGCACCGCCTGCTCCGCAAAG
GCAACTACTCCGAGCGCGTCGGGGCTGGCGCGCCGGTGTATCTCGCGGCGGTGCTTGAGT
ACCTGACCGCCGAGATCCTGGAGCTGGCGGGCAATGCGGCCCGCGACAACAAGAAGACCC
GCATCATCCCGCGCCACCTGCAATTGGCCATCCGCAATGACGAGGAGCTTAATAAACTCT
TGGGGCGTGTGACCATCGCGCAGGGTGGCGTTTTGCCTAATATTCAGGCGGTGCTGCTGC
CTAAGAAAACTGAGAGCCATCATAAGGCCAAGGGAAAGTGA
agagttaacgcttcatgcactgctgtttttctgtcagcagacaaaatcagcctaacagca
aaggctcttttcagagccacctacgacttccattaaatgagctgttgtgctttggattat
gccgcccataaagatgtttttgaggtgtttttaatggctttgagtgtggcacttttagta

Predicted peptide sequence(s):


>HIST1H2AB_1|GENSCAN_predicted_peptide_1|133_aa
XVVMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLE
YLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLL
PKKTESHHKAKGK