GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:15:06

Sequence HIST1H2AA_1 : 2864 bp : 45.18% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init -    819    440  380  0  2   70   82   419 0.619  35.88

Predicted peptide sequence(s):


>HIST1H2AA_1|GENSCAN_predicted_peptide_1|127_aa
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSX