GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:16:28

Sequence HFE_1 : 12009 bp : 44.56% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1422   1497   76  2  1   80   66   181 0.999  14.35
ctgctgtaggagagagagaactaaagttctgaaagacctgttgcttttcaccaggaagtt
ttactgggcatctcctgagcctaggcaatagctgtagggtgacttctggagccatccccg
tttccccgccccccaaaagaagcggagatttaacggggacgtgcggccagagctggggaa
ATGGGCCCGCGAGCCAGGCCGGCGCTTCTCCTCCTGATGCTTTTGCAGACCGCGGTCCTG
CAGGGGCGCTTGCTGC
gtgagtccgagggctgcgggcgaactaggggcgcggcgggggtggaaaaatcgaaactag
ctttttctttgcgcttgggagtttgctaactttggaggacctgctcaaccctatccgcaa
gcccctctccctactttctgcgtccagaccccgtgagggagtgcctaccactgaactgca

 1.02 Intr +   4822   5085  264  2  0   80   75   170 0.920  12.38
aagcacacaaggaaagagcacccaggactgtcatatggaagaaagacaggactgcaactc
acccttcacaaaatgaggaccagacacagctgatggtatgagttgatgcaggtgtgtgga
gcctcaacatcctgctcccctcctactacacatggttaaggcctgttgctctgtctccag
GTTCACACTCTCTGCACTACCTCTTCATGGGTGCCTCAGAGCAGGACCTTGGTCTTTCCT
TGTTTGAAGCTTTGGGCTACGTGGATGACCAGCTGTTCGTGTTCTATGATCATGAGAGTC
GCCGTGTGGAGCCCCGAACTCCATGGGTTTCCAGTAGAATTTCAAGCCAGATGTGGCTGC
AGCTGAGTCAGAGTCTGAAAGGGTGGGATCACATGTTCACTGTTGACTTCTGGACTATTA
TGGAAAATCACAACCACAGCAAGG
gtatgtggagagggggcctcaccttcctgaggttgtcagagcttttcatcttttcatgca
tcttgaaggaaacagctggaagtctgaggtcttgtgggagcagggaagagggaaggaatt
tgcttcctgagatcatttggtccttggggatggtggaaatagggacctattcctttggtt

 1.03 Intr +   5295   5570  276  1  0   25   86   238 0.987  14.79
aggttgtcagagcttttcatcttttcatgcatcttgaaggaaacagctggaagtctgagg
tcttgtgggagcagggaagagggaaggaatttgcttcctgagatcatttggtccttgggg
atggtggaaatagggacctattcctttggttgcagttaacaaggctggggatttttccag
AGTCCCACACCCTGCAGGTCATCCTGGGCTGTGAAATGCAAGAAGACAACAGTACCGAGG
GCTACTGGAAGTACGGGTATGATGGGCAGGACCACCTTGAATTCTGCCCTGACACACTGG
ATTGGAGAGCAGCAGAACCCAGGGCCTGGCCCACCAAGCTGGAGTGGGAAAGGCACAAGA
TTCGGGCCAGGCAGAACAGGGCCTACCTGGAGAGGGACTGCCCTGCACAGCTGCAGCAGT
TGCTGGAGCTGGGGAGAGGTGTTTTGGACCAACAAG
gtatggtggaaacacacttctgcccctatactctagtggcagagtggaggaggttgcagg
gcacggaatccctggttggagtttcagaggtggctgaggctgtgtgcctctccaaattct
gggaagggactttctcaatcctagagtctctaccttataattgagatgtatgagacagcc

 1.04 Intr +   6666   6941  276  1  0   84   63   255 0.983  20.09
ctccaagtgacactgtgttagagtccaatcttaggacacaaaatggtgtctctcctgtag
cttgtttttttctgaaaagggtatttccttcctccaacctatagaaggaagtgaaagttc
cagtcttcctggcaagggtaaacagatcccctctcctcatccttcctctttcctgtcaag
TGCCTCCTTTGGTGAAGGTGACACATCATGTGACCTCTTCAGTGACCACTCTACGGTGTC
GGGCCTTGAACTACTACCCCCAGAACATCACCATGAAGTGGCTGAAGGATAAGCAGCCAA
TGGATGCCAAGGAGTTCGAACCTAAAGACGTATTGCCCAATGGGGATGGGACCTACCAGG
GCTGGATAACCTTGGCTGTACCCCCTGGGGAAGAGCAGAGATATACGTGCCAGGTGGAGC
ACCCAGGCCTGGATCAGCCCCTCATTGTGATCTGGG
gtatgtgactgatgagagccaggagctgagaaaatctattgggggttgagaggagtgcct
gaggaggtaattatggcagtgagatgaggatctgctctttgttagggggtgggctgaggg
tggcaatcaaaggctttaacttgctttttctgttttagagccctcaccgtctggcaccct

 1.05 Intr +   8167   8199   33  2  0  124   92    43 0.593   6.49
aggtgaggagaccagttagaaagccaataagcatttccagatgagagataatggttcttg
aaatccaatagtgcccaggtctaaattgagatgggtgaatgaggaaaataaggaagagag
aagaggcaagatggtgcctaggtttgtgatgcctctttcctgggtctcttgtctccacag
GAGGAGCCATGGGGCACTACGTCTTAGCTGAAC
gtgagtgacacgcagcctgcagactcactgtgggaaggagacaaaactagagactcaaag
agggagtgcatttatgagctcttcatgtttcaggagagagttgaacctaaacatagaaat
tgcctgacgaactccttgattttagccttctctgttcatttcctcaaaaagatttcccca

 1.06 Term +   9904   9959   56  2  2  101   43    46 0.559  -0.88
caactgatcctcagctgtcatgtttcctttaaaagtccctgaaggaaggtcctggaatgt
gactcccttgctcctctgttgctctctttggcattcatttctttggaccctacgcaagga
ctgtaattggtggggacagctagtggccctgctgggcttcacacacggtgtcctccctag
GCCAGTGCCTCTGGAGTCAGAACTCTGGTGGTATTTCCCTCAATGAAGTGGAGTAA
gctctctcattttgagatggtataatggaagccaccaagtggcttagaggatgcccaggt
ccttccatggagccactggggttccggtgcacattaaaaaaaaaatctaaccaggacatt
caggaattgctagattctgggaaatcagttcaccatgttcaaaagagtcttttttttttt

Predicted peptide sequence(s):


>HFE_1|GENSCAN_predicted_peptide_1|326_aa
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
YDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
AYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWGGA
MGHYVLAERQCLWSQNSGGISLNEVE