GENSCAN 1.0	Date run: 16-Jan-104	Time: 16:44:18

Sequence FYN_1 : 214542 bp : 42.45% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1411   1657  247  1  1   61  115   123 0.619   8.84
agttgcgccatctgtcaggagcggagccggcgaggagggggctgccgcgggcgaggagga
ggggtcgccgcgagccgaaggccttcgagacccgcccgccgcccggcggcgagagtagag
gcgaggttgttgtgcgagcggcgcgtcctctcccgcccgggcgcgccgcgcttctcccag
CGCACCGAGGACCGCCCGGGCGCACACAAAGCCGCCGCCCGCGCCGCACCGCCCGGCGGC
CGCCGCCCGCGCCAGGGAGGGATTCGGCCGCCGGGCCGGGGACACCCCGGCGCCGCCCCC
TCGGTGCTCTCGGAAGGCCCACCGGCTCCCGGGCCCGCCGGGGACCCCCCGGAGCCGCCT
CGGCCGCGCCGGAGGAGGGCGGGGAGAGGACCATGTGAGTGGGCTCCGGAGCCTCAGCGC
CGCGCAG
gtaagcaggcggcggggatgcgtcgcgggaggcctcggggatgctgcggagaagcccggc
cgccggcgcccccgcgcacgccgcccccgccgcagggcccggtgctgcggtcccttggcc
gccagggcgctccgcggggctgccggggagtcggtgcttggggtcttcccgcggttgcac

 1.02 Intr +   1753   1856  104  0  2   86   33   185 0.756  10.85
gaccccccggagccgcctcggccgcgccggaggagggcggggagaggaccatgtgagtgg
gctccggagcctcagcgccgcgcaggtaagcaggcggcggggatgcgtcgcgggaggcct
cggggatgctgcggagaagcccggccgccggcgcccccgcgcacgccgcccccgccgcag
GGCCCGGTGCTGCGGTCCCTTGGCCGCCAGGGCGCTCCGCGGGGCTGCCGGGGAGTCGGT
GCTTGGGGTCTTCCCGCGGTTGCACCGGAGGACACCCCTGCGGG
gtgcggccccgaggcagcgcggggatggggaccccatttcctcgcccgcaagcgggcgcc
gggtgaaaatgggaattggcttgggggcgaggctggcccagactccgcccccgccctcct
tttggggccccccgcggggactggggctgtgtgtgttgttttaatgtcagggatgatgta

 1.03 Intr +   2403   2541  139  0  1   95   56    40 0.251   1.05
cccttcccctttcccctgtgctggagccttccctcctcttcctctgtcccccacccctct
gctccctccagctcttttctccttcctttccggctccctcgctggatttcctctctactt
ccctagatccatggctgtttttgtttgggctcctcccctctgttatctctgcggccacag
GCGGAGGGGACTGGGCCAGAAGGAGGCCACCGAGCTTGGGCCCAGCAGAGATGTGCTGGG
ACTCACTGGGAAGAGGGATAATAAAATCACCCTTCTTGCCCCTCCTTCCCCCAATAAATC
ACACAGACTCGCCGGGTGT
gtgagtgtgagtgtgacacaaagagccctttcagtgcatagagaggagacacacaaagta
ccctaggataggcacgatgcttcttgtctctcttccctggggcttccctttctttcccat
gaagcagttgatctctctgagtctttcctgccacatttaccaaaaaataaaagaaccccc

 1.04 Intr +   6604   6732  129  0  0   19   51   113 0.276   0.67
gaaatgctgggattttaggggtccatgtaggatggcagagagtgtgcagaatggagcatg
aacctggaaaagaggtgggcaagtgggatagccaagcagagaaggctggaagaggagggg
tctgaaggcaagatgagtagagatggctaggtgagtgttgtgggaagctccctgtcccag
AAAGAACAGCCCAGAGGGCGAATGCACAGACCTTTTGGGGAACTGCAGTTAGTTCAGGGC
TGTTTGGAGTGGTACAGAGATGGACAAAGGGAAATGACAGAGCTGAAGGAGAAACTGAGA
AAGATTCTT
gtacgtactttatcctgagtgccatttaagagttgtaagtggagatgtggctttgatgtg
attgtatttttataaagatctggccacagtatgggcctttgaccgagggcaggcagaact
aatgcagggaaggtagttatggaaacttaaatgagtagtagatgagggtctaaatggaag

 1.05 Intr +  20132  20275  144  1  0  100   89    39 0.313   4.76
ttgcaaaataaaatagtataacgattcaataaatgacaaaaacactgaaatgagagcatt
cagacaattctttaaaagatctgtagcagatctgtttcctgcgaatatttcatgtatgcc
taacctataactttctgtgttttccattaacccttctgactgctgttccgtgcatctcag
GCTGCAACACAGGTCACAGTGCAATGGTCAGCACATCTAGTGTCTGGTGAGGCAGTGGCC
TGGAATACTTTTCCTACTGCCAATCAAGACCGGAAGGAGTTAGCTGCCCTTAGCTGCTCA
TGTCCAAGTACTCTTTGTTTTATG
gtgagcatactgcgtgttgtccttgaaagggaggtgttgcttacaccacgattggaaagg
gacaggaaaagaaatggattgtcattggtcatctttcagctttaatcacatgttaacatg
aacgttcccttcactgtatagtcgtctcacacaccggtagacaaggtatgggagaagctg

 1.06 Intr +  27266  27554  289  1  1    3   86   131 0.284   0.30
ttcctgccttttttcatatttcttaactcaaagctctctgccctaacatattgttgtaaa
cataattccattcaactatttttattgttctctttagacactttattaaaactgcagctt
tattcaaacagctaaaattgcagataataaatgaagtaccataatattggccagttgtag
GCACAGCGTGTGAGCAAACTGGAAAGCTGCCATCCTGCTCCTGGCACTTTAAAGATTAAT
GTGAAGCATGCATGGGTGTCATCAGAACCAGCACTCAGCCTCGCCAGGGGCTTGGCACAA
GGTTCTAAGGTAGTCCCGGGGCTGGAGTTCCATGGACAAGATGATGCAGGCTGCTGGGTT
GGCAAACCTCCTGCAGAGGGGAACCCCAGCTGCTGGGAACCAGGGGCCATCCCCAAAATG
CTTTTTTTGACAGCGGGGCCCACCCACAGTCAGATAGGAAGTGGGGAAG
gtatgggctgggtgctgggggtgttttaatccaagaggtaaattgagtaagaccttggaa
gactcagttttaattgtgccccaaccattgatgacttgtagagactctgaaaaagggaag
tgtgtttgtgtttgtgtttgtgtgtgtgtgtgtatgtgtgtgtgtacacacaaggcctct

 1.07 Intr +  27996  28036   41  1  2  119  106    69 0.801   8.82
cagacaggtgtttgtggcaactgtgacttagcaacaattgtgtgaatgataaaaaatttg
tgggcaaattgattgtctgcaacaaatggaaattctatggtggtgctttgtgggtggttt
gtaggcagagagtacttggttctcttttgatgtctcacttttttttttcttcttctacag
TTTTTTTGAAGAAGCAGGATGCTGATCTAAACGTGGAAAAA
gtaagttggcaagttttgcactgagagcaagtgccttgtgaattataaagggcttcctgt
tggaacctaggatgaagtccacttttaatttgggattgtaattctgagtccatagatttc
taagagagaggtcgagttggagaaggaactggtttgtgaaatagaaagaaaaccttacct

 1.08 Intr +  31539  31643  105  2  0   67   32   104 0.185   2.19
atatccacttcaactactctcaaagggctgaggagagaggtttggtttccgtgcatcctg
gatggcctttgtctggtgtgattaaaggtatttcagtgcctgccatgagagaggcccctg
ccatttctgcagtttcagtgagaccgagaattcctgcagtgtcattccaactgtttgcag
GGTTTAGACAGCTGCGTTCAGGCCACAAATATGGCCACAAACACTACTGCCTATTTGATA
GACACAGAGGCCTTCCGAAACAAAAATTGTCATTCAAAAAGAAAA
gtaaaaagaaaaattacctcctgccttagaattgtttacttttcctctgagtgagtgagt
tctttgaaatgtgttggtctgttaatgtagaatgtacatggaagttgctccatttttcag
tgtttctttggttttaataagtcccaagagaaatgataaaaaacctcctagattcttagt

 1.09 Intr +  46587  46684   98  2  2   86   61    78 0.660   2.79
cagtaagcaatttctgcttgctccaaggggccagaaacctcaggatgctggctggggaat
ttggccattaagtttccagcccaaggacaaggtcagcagtgcagtcccaggagctgcaga
agaggaggaagttctcagggtacacagtcaactgtaaccagggttcctccgctactctag
AACAACACTGTCAACTTGACACGGAGTGAAGCGGCCATTGTGGTGCTGAGGTTGTTTTGG
ACTGCACTGGTTGGACAGCATCTTTACTGGCCAAGAGA
gtaaggagggcaagcctgcctgcctctgtgcagttaggggcctggggaaagctttatgat
gagaagtgtcagatttcagaatccaccgtttcccccatctcccccaagaagaaagagtac
ccttagtcaaaatctaaatgggctcctcagcagggcttgttgtgttgactcaatctaatt

 1.10 Intr +  48820  48994  175  1  1  116   63    63 0.541   5.62
tcgccctaactcttaatgtatccagacccacccaatccagtgtcagaatgatatgagtca
aagaaatacaatctagtgacagtaatttcagaatagcacatcttgacttgtctttctcaa
taccatagagggatatagaattacagcaatatttctttaagtccctctttttccctccag
CTTTCCTCACACGTTACAGCCCTTACAAATGAGCCCCCAAGCCTTTCCTAACTGTGGCCC
ACCTGCTCTCCCACCTTTCCTCCTGATTCTGCATCACAGAACTCCCCCAAACAGGTCAGG
GCAAAGGGAAGAACCAGGAAGGCAAAGCCAGAGTGCACATGAGCAGCTGGGAAGA
gtaagcctgggaatatgtgttactaacttccattccctcacacgaccatgtgtgtctgca
ctgcactaggcattcttctatcttaccttatataatttaatgctcacagaaatcctgtgt
ggtaggtattgagatcttcattttactgatgagaaaaccacagtcagagaagcttagtaa

 1.11 Term +  49707  49865  159  2  0   46   40    78 0.315  -4.24
attcctacgcatcagaggcaatggctttctgactctgtcagtcttctagcaggttttaca
accagtggagtgctcatgttaggcctgaccatctgaggcaatgcctgcaatgctcagaga
tgggagctcagaggagttttcagaagtaatgaaaactttaaacaattccttaatcaccag
AATAAAATAAAGATTCTTTTTGACAAATGCATTGGTTCAGTTTATGAATTTGTGAACTTG
ATTCAGATAACCTTAGGAGTAAAAGTGTGCAAGACCTCATTTTGTGGCTACCTGGTAACA
CTTTGGCTGAAAGCTAGTGTTCATTTGAATAGTGAGTAG
tggaggggacagggtctgaaaatgaaagaaggcataagagacctgagaagaaaaatagct
aaacccaaacctaagcaaataaaaagtgaaattcagagtaatgactgggggagagtaaag
caaaatagatgagacagagtgagcacagaaagataagttagaggagaactatatgtgacc

 2.03 PlyA -  50948  50943    6                               1.05
 2.02 Term -  51524  51271  254  0  2   64   35   181 0.954   5.22
 2.01 Init -  51748  51637  112  1  1   73   50   112 0.636   6.32
 2.00 Prom -  52467  52428   40                              -3.65

 3.05 PlyA -  52478  52473    6                              -3.94
 3.04 Term -  53507  52660  848  0  2   40   42   282 0.306  10.85
 3.03 Intr -  56456  56324  133  2  1   31   80    54 0.217  -1.80
 3.02 Intr -  66051  65647  405  0  0   36  123   179 0.250   9.82
 3.01 Init -  70869  70762  108  0  0   37   80   109 0.627   5.27
 3.00 Prom -  71067  71028   40                              -6.35

 4.15 PlyA -  71222  71217    6                               1.05
 4.14 Term -  74335  74019  317  2  2   42   49   204 0.840   6.02
 4.13 Intr -  92331  92227  105  1  0   59   89    70 0.158   3.47
 4.12 Intr - 111774 111735   40  0  1  102   80    33 0.310   0.78
 4.11 Intr - 112781 112579  203  0  2   56   37   173 0.066   7.08
 4.10 Intr - 115156 114997  160  1  1   93   48    39 0.767  -0.96
 4.09 Intr - 115525 115442   84  1  0   95   95     1 0.314   0.60
 4.08 Intr - 117045 116954   92  1  2   72   80    71 0.076   3.49
 4.07 Intr - 125339 125196  144  0  0   32   19   132 0.026   0.03
 4.06 Intr - 125527 125445   83  0  2   62   99    15 0.020  -1.64
 4.05 Intr - 136253 136149  105  1  0  111   47    70 0.335   3.61
 4.04 Intr - 138250 138103  148  2  1   40   95   118 0.543   6.07
 4.03 Intr - 140043 139909  135  1  0   99  -34   145 0.129   3.02
 4.02 Intr - 142237 142155   83  0  2   76   80    20 0.091  -1.64
 4.01 Init - 142903 142623  281  1  2   77   67   157 0.163   9.03
 4.00 Prom - 147601 147562   40                              -6.35

 5.01 Init + 154574 154820  247  1  1   50  115   288 0.967  25.50
aactgaacttcctcctaaccatctccccagccactgcctttcctcatgccccctaatagg
cctgaaatagccaacagtgagccttgtcaattactcctcgtttactgtagagcaacccag
caactagggagcatcccagcttacgtgcccccttttttgtctttggcaggaatttagata
ATGGGCTGTGTGCAATGTAAGGATAAAGAAGCAACAAAACTGACGGAGGAGAGGGACGGC
AGCCTGAACCAGAGCTCTGGGTACCGCTATGGCACAGACCCCACCCCTCAGCACTACCCC
AGCTTCGGTGTGACCTCCATCCCCAACTACAACAACTTCCACGCAGCCGGGGGCCAAGGA
CTCACCGTCTTTGGAGGTGTGAACTCTTCGTCTCATACGGGGACCTTGCGTACGAGAGGA
GGAACAG
gtaagcccccaaagtcacagagtgcagagagggggcagccacccttaaatcttttggcaa
ttgaacatctgggttcccatcacttccctttgactaggggtttcacatgtaagtttctaa
tctgtctcctctactagatgaggggttgtaagaaaagccagagtttgatgtacaaacaaa

 5.02 Intr + 160182 160278   97  1  1   95   99    94 0.995   9.35
ccaaggcataaacacagccctgtgactgtggttttgacacgttaattacaacacttcatc
atgttattagtgctggctagatgtagattgtgagaatgagattttagtgaagatttaatt
tcttggaattaatttccccttgtgtaataatctcccttcttgtgaatttcgtttcggcag
GAGTGACACTCTTTGTGGCCCTTTATGACTATGAAGCACGGACAGAAGATGACCTGAGTT
TTCACAAAGGAGAAAAATTTCAAATATTGAACAGCTC
gtaagtttggagagggaggagaagcatgtatacctttcaggttgggaaggggtcttgcat
ttctggtctgcatctcttcagatgtctgaaatgctaaaagaacatttgctaaattcactg
gtttacaacaatatactttgagaaaaagaagagtcagtgacacagtgcagtattttatgg

 5.03 Intr + 165468 165647  180  0  0   65   71   142 0.901   8.26
ttgagtttaatgtggaggctgattattctctacctgattaaatctgtctggggagcatct
ttaccatggccagaagctaacacattttttttttcccctggctgaaagctttgacacaga
actcagccaaaagaacgatttttttttaaaatgcctgaagttttgcttgctgcctccaag
GACCAAAAAAGGAGGAAAAGAAGGTCCTGAGCCCCAGGAGATCAGATTTGCTGGGAGGTC
TGATTTGCTTGAGGGCAATCATGTCGTTGACTGCAGGCTGGTGGAAGGTTCTGCAGATAC
TCAGTGGATGTCAGAGCCGCAGCGCCACATCCATGGCCTCCCCGATGTTAATGGGAAGAG

gtacacactccattcctgctcttcatcacaggtagccctgtttgaatctaagcagatgaa
tttgaactgcttaatgtactcactggctttaagatgagagtagctacaagatcccctttc
acctcctctgagagctccccagattgataccacactgctgtgctgtggcatggagcctaa

 5.04 Intr + 166605 166703   99  0  0  107   36    57 0.619   0.71
cgaactggaaccttctgaccttcacagggggactatgttggagttcagagtaaaggaata
ggttggagaaatcgggtggcaggatgattaggtgacagttatacacttcagaccacagtg
agtctctaactgcaagctgttgaaatggtcaacatatttacttttcttttttatttacag
GGAAGGAGATTGGTGGGAAGCCCGCTCCTTGACAACTGGAGAGACAGGTTACATTCCCAG
CAATTATGTGGCTCCAGTTGACTCTATCCAGGCAGAAGA
gtatgtttcattttgttttcacttaactacttgattttaaaagttgattgccgcaataaa
atgccatcagcattgggcaggagggagaagaaattcacagcagtgattaaggctgagttt
ttcaggctttctgccccggtttttaccctgtgtaatacttgcactattattaacttaatg

 5.05 Intr + 170523 170626  104  0  2   53  116   117 0.999   9.90
ggatagaatccaggatagattgaaaaggaactgaattaagctagaaaaaaaatacatcca
gggaaaggttaaggactaaattggaggagaggggaattcatgggcaaaaaaaaagcctat
gctgttgcattttgtaaatgactatttcaaaatattttctttccttgatctaatttaaag
GTGGTACTTTGGAAAACTTGGCCGAAAAGATGCTGAGCGACAGCTATTGTCCTTTGGAAA
CCCAAGAGGTACCTTTCTTATCCGCGAGAGTGAAACCACCAAAG
gtaagataacgagttgaagaagttggcttgtcattcaaatctgtggattagtcagagggg
atgaaaggcttatctctaatgtacaaggattttaaaatggcacataccctccctgccttg
tgagtggagtcctgttttcagtcttccctccaggctctaaaactgcagacagcaccaaaa

 5.06 Intr + 171591 171740  150  1  0   71   91   146 0.995  12.41
tctgacatttgcagaacatcaagaagcatcttcttcctgttactgagtggagatgctgtg
tgtgtgtacatgtgtgtgtgcatccttggtaattattaatcagagtcaagaaaatgaggc
ctaaaaagcaagctgatactctaaatgattggagctgctaatgctttccacgtttaccag
GTGCCTATTCACTTTCTATCCGTGATTGGGATGATATGAAAGGAGACCATGTCAAACATT
ATAAAATTCGCAAACTTGACAATGGTGGATACTACATTACCACCCGGGCCCAGTTTGAAA
CACTTCAGCAGCTTGTACAACATTACTCAG
gtaaccttaattctaactacctactaaccatttggatgctggagggagtggataggccca
gagcaggaaagtggaaaggggtaaaactaatatgtacaaaatcacttatagagtatgttt
tctttgccagcccttaatggtagggcttggctgtataggttctattgctattgttctact

 5.07 Intr + 174357 174521  165  1  0   84   59   105 0.963   6.21
gcgctgtttaaggagcgctgtgtgctgctagtgttccacgatgtgtgtggtcgtctgctg
gtgtagtagcactgtttgaggagcactgtgcgccgctagtgtgggtttacacttatgagt
gttgtcattacatgtgttctgctcttctctccctctcctgcccctgccctgctccatcag
AGAGAGCTGCAGGTCTCTGCTGCCGCCTAGTAGTTCCCTGTCACAAAGGGATGCCAAGGC
TTACCGATCTGTCTGTCAAAACCAAAGATGTCTGGGAAATCCCTCGAGAATCCCTGCAGT
TGATCAAGAGACTGGGAAATGGGCAGTTTGGGGAAGTATGGATGG
gtatgctgagactcaattactctcttattagcttccccgtttggaagatcccaaacacca
aagatggaaggtgaaaataaagactgcgtgaccgggaagaaagtttgaattactaatagt
ggggaataataatttcagttttggttttaacattctggaattcctaaaaaaaaaaaaaaa

 5.08 Intr + 174955 175110  156  2  0   74   87    79 0.864   5.46
aaaccagcaaatggtccaaggaatgttccagctgccataaaatatcttgctcttcatttc
caaaagcaaatatttgttgagtgtcatcctaacgggcaagtcaccttccatctttcctag
tgcatgcataattatggattataaggactgtgttttctttattaattccctttcctgtag
AGAAAGCTGATGGTTTGTGTTTTAACTTAACTGTGATTGCATCGAGTTGTACCCCACAAA
CTTCTGGATTGGCTAAAGATGCTTGGGAAGTTGCACGTCGTTCGTTGTGTCTGGAGAAGA
AGCTGGGTCAGGGGTGTTTCGCTGAAGTGTGGCTTG
gtaaggcagagggcacattttgttttggctgcatctcaaagccgattaaaaggatggttt
tgaacaaaaatgcacacacagccgttgggacaaagacacttaacctggataactagacgg
gcacaggccatccagattttcagaatatgctgataccttgctgtgctcatctgtcctact

 5.09 Intr + 178169 178348  180  0  0   59   53   219 0.958  14.42
actcattttttctgttaaaatacttgacagagtccttgcaattgaatgtctttgttcaac
aaaaactgtattaagtgttttaaatttaaaatctaatcttatgcaaatagctggtggtca
aaacctttttccatcaaaagaagatctttggtttgacttcatattctgggatgtttgtag
GTACCTGGAATGGAAACACAAAAGTAGCCATAAAGACTCTTAAACCAGGCACAATGTCCC
CCGAATCATTCCTTGAGGAAGCGCAGATCATGAAGAAGCTGAAGCACGACAAGCTGGTCC
AGCTCTATGCAGTGGTGTCTGAGGAGCCCATCTACATCGTCACCGAGTATATGAACAAAG

gttgggcaacacctctcctgtctccagctcacagtgccttaaggggttgtttaggggaga
gaaatggaagtttcctacttgctacttttctagtttctgcctgggtcaagtattcccatt
aggaaccaccagttatgtgctcgttaatgaaaacattttttaaaacagactaaccttgcg

 5.10 Intr + 179921 179997   77  0  2   78   96    98 0.999   7.92
cttctccatgcctatacttttttctaccctgcttttttatataaacctttttgtcccccc
atgtggatggcattattccatttgactaccttattacttttaataagaaaaccaaataca
gctctctgttgggaattatctttcaaagtaaattgaaatgattttatgttttgttcatag
GAAGTTTACTGGATTTCTTAAAAGATGGAGAAGGAAGAGCTCTGAAATTACCAAATCTTG
TGGACATGGCAGCACAG
gtaggccctgcagggtaacttgatgtgccatagatttaatgacgtgtctaagtacattgg
gtcgtggtgtaacatgtcctgttccctgggtttccacaggtggctgcaggaatggcttac
atcgagcgcatgaattatatccatagagatctgcgatcagcaaacattctagtggggaat

 5.11 Intr + 180097 180250  154  0  1   97   86   135 0.951  12.92
ataggaagtttactggatttcttaaaagatggagaaggaagagctctgaaattaccaaat
cttgtggacatggcagcacaggtaggccctgcagggtaacttgatgtgccatagatttaa
tgacgtgtctaagtacattgggtcgtggtgtaacatgtcctgttccctgggtttccacag
GTGGCTGCAGGAATGGCTTACATCGAGCGCATGAATTATATCCATAGAGATCTGCGATCA
GCAAACATTCTAGTGGGGAATGGACTCATATGCAAGATTGCTGACTTCGGATTGGCCCGA
TTGATAGAAGACAATGAGTACACAGCAAGACAAG
gtgggcacttgaatgacaatggctcgtgatcacagctgtgagaacagtcacttactgcac
agcccttccttcctccttcccttcccttccttcagaaaatacttgaaatgtcattcttca
gcttggtttggacaccttgatctggcaggaatttgacagctctgcaggtgggagactgtt

 5.12 Intr + 180838 180935   98  2  2   55   47    52 0.375  -3.39
tcagagcttgtaacagcaacagaactaaggcctcaaaggtaagggggcagagaagtgggc
acaagaagtcagaatgggccactgcacagagagggcctcctcagtaaagagagacgtcag
ggatggatctggggattcacacccaaccccactctagcccacttctgggtcttctgccag
ACCCAACCAGAAGTAGAGGTCACAGGAGCTCAGCGATGAATCCTTATGGGTCCAGAGCAG
GGAGAGGGAGAGTGGAGAGTGGACTTACACTACAGATG
gtaacagcatagttactcgaaaatctctacctcctttcatcatccccgccatcccaccct
ctgcaaaaatttatagaaattagcctttaagtaaaatatatcccaactcagcagccattc
cagtggggcagcttttcaggtgctattagagcaccagatactagaaaggagtttttagga

 5.13 Intr + 182191 182309  119  0  2   71   55    79 0.024   1.24
tggttaacgctcatgaaccatgggtaaatgaaaaggttgccaggccaggagccagaggat
gctggcaggggtgctgttaatagggcctgggggtttagtccacgccttattcactggagt
gaggctcctcaggctgtggccctaggtgattggcaccctcgctggttcccctcccatcag
GCTGCTGCCCTGAGCGGGTCCCAGGCTGCTGCCCTCAGCCTGGCCCCCAGCCGTTCCTCT
GCATTAGCTGTCCTGATTGCCCTTCTGCCGGCTGCCCAGCTGCACCATCATGTCCCCAG
gtgccgtcagagcccctttcaaaaggccaaccttgttcttttagcctttgtactgcgttt
ccttacttaatttccaaatcgagggtcccgtccttccttcttcaaacatttttcttcttt
cctccctttcccaaacaccttcaaatccatgccaaacactagaaagagagaagtaagaag

 5.14 Intr + 189304 189454  151  1  1   75  109    76 0.104   7.64
cattgctctgccatccccagggtggctcccccattggcacagacactgtaccagattgaa
aaggggagcggtttgaaaaagccaccccaaagtgatgtttgtcttctgtatatcctatta
tcctttgatatgttctgagctcccagtcaaaccccgtgacctccaactgttcccacacag
TATCCCCAAACCCAGTGCTGCCCATGCAGCCCAGCTCGTCATGTGGCATGAAGTCAGACT
GACACGGGCCCTCTGCCCCTTCTGGGGGTGGCTGGATTCTTGGCATCATTTCTGTGTTGA
GCTACATCCCACACATCCGTTGATCACTCAG
gtgagttcctctcaccaccctgggcagcagtgtgcagttggttacaaagctcttgtcttt
tgttctggattgaaagtccgcaaacatagcgtttatgctgttgaagctgtgaatcagaat
ttttattctgtttgttttgttttgttttgttttctctttacagaggtaatcaagttacag

 5.15 Term + 191647 191766  120  0  0    5   52   124 0.068  -2.01
ctgtctccctggctgcctagaaaccccaagggcggaggcaacctgtgcttggttttccca
ggagcgcctcacagggtgctggggacatcatggaccctcagaagattctcagtgattggt
tgatgagtgttttgattaggagggttttttcatcttcttttcctcttctgatgtttggag
AGCTTTGGCATTGCTGATGGCATTTGCCAGTGCAACTCAGGGACTTTAGGCCTTTACTAT
CTGAATAAAATAACAGCTGGTATTTATTCAGCTATTACCAGGTACCAGACGCTGTGCTGA

gccttttacatcaactgttcttcccaccacaaccttaggaggttatcatccccagtttac
agacaaggaaactgagacttagggatgttttaaatgatcaaccagcaaatccagtgtgca
agcacagggatacctgactcggaagctcctttcctaaatgatcatagtggtccttccaca

 6.01 Init + 198101 198206  106  1  1   36   85    77 0.739   2.63
atttccaagccatttggctcaagagatggtttaaataggaatgaatgtagtataccttta
attctctgaagtaagagaactccagctgaggtttggtccagagcaaagtctgctctcaac
attgaagaaaatctatcacattaatcccagtggctcagagtccaaagctgcgtgaacaga
ATGCTAAAGGATAGGAAGTGTGAGAAGAATGCTTTGAAAGAAACCTTAAAAACAAAACAA
CTGACTATTCAGAGAATACCAGGTCTTATGTGGAATCATCTAGCAC
gtaaggaaagatataaataattatgcctgagaaacataactaattaaaaataactccatg
cataaaaggaaaactatagaataacttttctgctccagtgttaatgtgagatgcctcata
atgaaatagtaggatttttttctttcatttcatttcacacagacacatgagagatggaga

 6.02 Intr + 199995 200126  132  1  0   89  110    81 0.881  10.10
cacagtcaagaccagaccctacatcttcccaatcccagcccattcctgcttcacctcctt
tctgtcttcccctctaaacctgctctcaggaaagtagcttgccaagtgcctttccctccc
acaccccatgcccattgcagtgccctctgcctgatgaataaccaagtgttcattctgcag
GTGCAAAGTTCCCCATCAAGTGGACGGCCCCCGAGGCAGCCCTGTACGGGAGGTTCACAA
TCAAGTCTGACGTGTGGTCTTTTGGAATCTTACTCACAGAGCTGGTCACCAAAGGAAGAG
TGCCATACCCAG
gtaagagcagggcctcacagacatgggcctgagattggaggcttttttgacaccatttgg
gaaaacttcatccactttgctttctaagccccatcctcagctttctgctgagcttgagtt
tgaagaacatggccaggtattcagcgagagaaaagcagaactgggagccaccatgtatgt

 6.03 Intr + 209640 209789  150  1  0   72   76    60 0.103   2.41
aatatttcaaaatcctaaaaaatctgaaatttaaaacactcctgatcataagcatttcag
agaagggatactcaccctgaattaacacaatccattcaatttagctattgtttataaaat
aaaaactagcccaagccttgctgagtgggcatatcttgattgccaccgttattgttgcag
AGGTACATTGTGAAGTTGCCAGGTCTGCAGGTCAGCCCGTTGCAGGTCCTGGTTTATGGA
TGGTTGGAAAAGAGCTAGTCCCATTCCAATTGTCATTGTCAGCCAAGTGCATTGTCAAAA
TATCCCACTTTCCTGGCAAAGCCCTCATTG
gtatgtttccacttggcccagtgcgtggaattgttttcatatactccccttgctttgaga
ggtctgggcagaagaaagcaggagaagaagaggagtggggaagagcggaggggtgcagac
aggaaaggggagagcgagaaggagcctgaccatgtgggtctgccaggaccctgcatgggc

 6.04 Term + 209851 210110  260  2  2   10   37   257 0.119   7.53
tcagcccgttgcaggtcctggtttatggatggttggaaaagagctagtcccattccaatt
gtcattgtcagccaagtgcattgtcaaaatatcccactttcctggcaaagccctcattgg
tatgtttccacttggcccagtgcgtggaattgttttcatatactccccttgctttgagag
GTCTGGGCAGAAGAAAGCAGGAGAAGAAGAGGAGTGGGGAAGAGCGGAGGGGTGCAGACA
GGAAAGGGGAGAGCGAGAAGGAGCCTGACCATGTGGGTCTGCCAGGACCCTGCATGGGCC
AGCTTATGCCCTGTCCCCTGGCTCCAAATGCCCAGGAAAGACTGCCTCGGGAGACGCTAC
ATGTTGAGGTTCACATCACCAAGTGTGCTGTGTCTGAGGCTTGGACCGAGCACTGGAAAA
ATGACCCAGTGGCCAATTAA
actttccattggcagacattggatgaaaactttttttttaagtgaaatctttccatttga
gtagtttgttttttaatgaaatgaaacatgtactgacatgcgctctgtggagcaatagga
gagtgattaattaaactctgtgctgccattttggagggaggcactcagagccagagtcaa

 7.01 Init + 212530 212882  353  0  2   63   67   248 0.760  16.89
cccaggcagccactgatctgctttctatagatgtagttgcgccttttctagaatttcgca
tgaatgaaatcataccgtatgttgcctgttgtgtctggcttccttcacttatcatgtttt
gagagtcattctgaatttttcatgtctcagttctgcactccttctttactcctgagtagc
ATGGCAGGGTTTGACTCCTGGGGGGATGGGAGTACTCCGCATGTTTTAGCCACATGCAGA
CGCAAAGAAGAAGAAAGGGGATCTGCAAGTGCGGCGGTCAGGGCCTGGATCCCCGGGGTG
CCCACTCTCACTGCGCTTGTCTTTGCAGGCATGAACAACCGGGAGGTGCTGGAGCAGGTG
GAGCGAGGCTACAGGATGCCCTGCCCGCAGGACTGCCCCATCTCTCTGCATGAGCTCATG
ATCCACTGCTGGAAAAAGGACCCTGAAGAACGCCCCACTTTTGAGTACTTGCAGAGCTTC
CTGGAAGACTACTTTACCGCGACAGAGCCCCAGTACCAACCTGGTGAAAACCT
gtaaggcccgggtctgcggagagaggccttgtcccagaggctgccccacccctccccatt
agctttcaattccgtagccagctgctccccagcagcggaaccgcccaggatcagattgca
tgtgactctgaagctgacgaacttccatggccctcattaatgacacttgtccccaaatcc

 7.02 Term + 212960 213077  118  2  1   63   48   140 0.571   4.53
ggaaaaaggaccctgaagaacgccccacttttgagtacttgcagagcttcctggaagact
actttaccgcgacagagccccagtaccaacctggtgaaaacctgtaaggcccgggtctgc
ggagagaggccttgtcccagaggctgccccacccctccccattagctttcaattccgtag
CCAGCTGCTCCCCAGCAGCGGAACCGCCCAGGATCAGATTGCATGTGACTCTGAAGCTGA
CGAACTTCCATGGCCCTCATTAATGACACTTGTCCCCAAATCCGAACCTCCTCTGTGA
agcattcgagacagaaccttgttatttctcagactttggaaaatgcattgtatcgatgtt
atgtaaaaggccaaacctctgttcagtgtaaatagttactccagtgccaacaatcctagt
gctttccttttttaaaaatgcaaatcctatgtgattttaactctgtcttcacctgattca

Predicted peptide sequence(s):


>FYN_1|GENSCAN_predicted_peptide_1|543_aa
XAPRTARAHTKPPPAPHRPAAAARAREGFGRRAGDTPAPPPRCSRKAHRLPGPPGTPRSR
LGRAGGGRGEDHVSGLRSLSAAQGPVLRSLGRQGAPRGCRGVGAWGLPAVAPEDTPAGRR
GLGQKEATELGPSRDVLGLTGKRDNKITLLAPPSPNKSHRLAGCKEQPRGRMHRPFGELQ
LVQGCLEWYRDGQREMTELKEKLRKILAATQVTVQWSAHLVSGEAVAWNTFPTANQDRKE
LAALSCSCPSTLCFMAQRVSKLESCHPAPGTLKINVKHAWVSSEPALSLARGLAQGSKVV
PGLEFHGQDDAGCWVGKPPAEGNPSCWEPGAIPKMLFLTAGPTHSQIGSGEVFLKKQDAD
LNVEKGLDSCVQATNMATNTTAYLIDTEAFRNKNCHSKRKNNTVNLTRSEAAIVVLRLFW
TALVGQHLYWPRDFPHTLQPLQMSPQAFPNCGPPALPPFLLILHHRTPPNRSGQREEPGR
QSQSAHEQLGRNKIKILFDKCIGSVYEFVNLIQITLGVKVCKTSFCGYLVTLWLKASVHL
NSE

>FYN_1|GENSCAN_predicted_peptide_2|121_aa
MRTQERACHTRESSNFHMAATVEQQQWKYNCSRVKTGYGYRKILVNFTKIYSAFAVTNSD
YEWQPTLVAIGYRCGDPQGTERRTQKPPTEVVTTQLQPQPWLLRGHVGLVLLDHPIFKEK
P

>FYN_1|GENSCAN_predicted_peptide_3|497_aa
MKQLAKDNFILAANSANVEFPEGIICGNAQLPKAAMKPKGKELTDVVHRSQFSGAQSRVE
SIWIQRSMTKTPGAKLQKQAYQGVSNPHHHHHTGQQLKAVPHPLMEAPDAIGNCRVLPVT
FEMTQLRPEKSFNNKFTNVLIKYLWSTYSMQEMISYFSHVVKVSMCFMLNSYLPPNNPAQ
KWQGERLRETKRDHWEKTYTSTTSLHAIPGCNINPELEKTTLKFIWNQKRARIAKSILSQ
KNKAGGITLPDFKLYYKATVTKTAWYWYQNRDIDQWNTTEPSEIIPHIYNHLIFDKPDKN
KKLGKDSLFNKWCWENWLAICRELKLDPFLTPYTKINSRWIKDLHVRPKTIKTLEENLGN
TIQDTGMGNDFMSKTPKAMATKAKIDKWDLIKLKSFCTAKETTIRVNGQPTEWEKIFAIY
SSEKGLISRIYKELKQIYKKKKPHQQVGEGYEQTLLKRRHFCSQQTHEKMIIITGHQRNA
NQNHNEIPSHTSQNGDH

>FYN_1|GENSCAN_predicted_peptide_4|659_aa
MAQEDGNKRSREADSSQPPPTLYCLKERRMVSAFPDVGFLTLGEPRVVEYVVRVSVKFSL
EVCIYECKLSAKRDTEEIKGGTSVRGRECGTTRRILVSGRVALGLKGHGLGNLAAQIHVT
ERRLHFSLALPYRVARYSCSPSELLEMKLEENNNKNEETTPPTPNKSLEQSEDVNSCSST
SKSHQSAALAEALCPSTKQNWPVPESSDGAALEDSRGLGLKAYNLNSHLFLESGAPKAHG
CSQAKLLTGEGHYNGSSRSSRTLLLVLTFGICGKFLRAVSLEQQLKLNGNDNHVYDTQTE
LPYGKEDACSMYPNEWVLLDKIILVIAYNKVSRKWPSKMASHIRKEMDAMKGDIGQELLG
LYPTLDHLQVRQSHCLTVSCAWQGLPSCSGANRTEAVHNGAGSSRLLTPRHPGTRCPFSS
RTVDLLVPPLGVLALQDFAKKMLSRIPWTGYLHPIIIPNAETAQQSLVSSPSKQDLHYIM
EECGWLDVFYVKKLVMPFREKEQLQHVTKKVLAFKWLDTVNNASPYHSTAGRRSSGLLSP
STGNGAICLSYMSSVITRYPRRAENEAQVSAQGRKDPGDGRNKALQLVGGSVGRVLTATH
GSGAGGMDTTCRRDIEYEEGRKRKRTKSELDAEGIYYDLKRERLQPRFLNLSQAHPIFF

>FYN_1|GENSCAN_predicted_peptide_5|698_aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSTKKGG
KEGPEPQEIRFAGRSDLLEGNHVVDCRLVEGSADTQWMSEPQRHIHGLPDVNGKREGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMEKADGLCFNLTVI
ASSCTPQTSGLAKDAWEVARRSLCLEKKLGQGCFAEVWLGTWNGNTKVAIKTLKPGTMSP
ESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLV
DMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQDPTR
SRGHRSSAMNPYGSRAGRGRVESGLTLQMAAALSGSQAAALSLAPSRSSALAVLIALLPA
AQLHHHVPSIPKPSAAHAAQLVMWHEVRLTRALCPFWGWLDSWHHFCVELHPTHPLITQS
FGIADGICQCNSGTLGLYYLNKITAGIYSAITRYQTLC

>FYN_1|GENSCAN_predicted_peptide_6|215_aa
MLKDRKCEKNALKETLKTKQLTIQRIPGLMWNHLARAKFPIKWTAPEAALYGRFTIKSDV
WSFGILLTELVTKGRVPYPEVHCEVARSAGQPVAGPGLWMVGKELVPFQLSLSAKCIVKI
SHFPGKALIGLGRRKQEKKRSGEERRGADRKGESEKEPDHVGLPGPCMGQLMPCPLAPNA
QERLPRETLHVEVHITKCAVSEAWTEHWKNDPVAN

>FYN_1|GENSCAN_predicted_peptide_7|156_aa
MAGFDSWGDGSTPHVLATCRRKEEERGSASAAVRAWIPGVPTLTALVFAGMNNREVLEQV
ERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENLQL
LPSSGTAQDQIACDSEADELPWPSLMTLVPKSEPPL